Domain-Name-Registered.Com

Domain Name Registered on Tuesday Jan 22, 2019 page 2.

There are hundreds of thousands of domains were registered daily, and this place DOMAIN-NAME-REGISTERED.COM is where you can check out almost domains are registered by day. Our domain database is to update list of domains by day, registrar, and extension. Lists contain daily changes (yes, some registrars do register 100k+ domains!). .

Where does this data come from?

All of our data comes from analyzing publicly accessible database from domain registrars. Due to registry restrictions we are only able to download the zones once per day (hence the 48 delay in processing).

#
Domain Name
Main Domain
www
https
Length
Ext
501
foltonbank.com
foltonbank.com
foltonbank
14
https:// www. foltonbank.com
com
502
famousvibes.com
famousvibes.com
famousvibes
15
https:// www. famousvibes.com
com
503
faithfullyjoyful.com
faithfullyjoyful.com
faithfullyjoyful
20
https:// www. faithfullyjoyful.com
com
504
favesli.com
favesli.com
favesli
11
https:// www. favesli.com
com
505
fortunegourmetchinese.com
fortunegourmetchinese.com
fortunegourmetchinese
25
https:// www. fortunegourmetchinese.com
com
506
funsunglass.com
funsunglass.com
funsunglass
15
https:// www. funsunglass.com
com
507
fbcjj.com
fbcjj.com
fbcjj
9
https:// www. fbcjj.com
com
508
fjjsjyw.com
fjjsjyw.com
fjjsjyw
11
https:// www. fjjsjyw.com
com
509
fix-my-tech.com
fix-my-tech.com
fix-my-tech
15
https:// www. fix-my-tech.com
com
510
fletesmar.com
fletesmar.com
fletesmar
13
https:// www. fletesmar.com
com
511
fd8sam.com
fd8sam.com
fd8sam
10
https:// www. fd8sam.com
com
512
flightexpertsales.com
flightexpertsales.com
flightexpertsales
21
https:// www. flightexpertsales.com
com
513
fourmatix.com
fourmatix.com
fourmatix
13
https:// www. fourmatix.com
com
514
floridabayadventuresinc.com
floridabayadventuresinc.com
floridabayadventuresinc
27
https:// www. floridabayadventuresinc.com
com
515
firstrungcrypto.com
firstrungcrypto.com
firstrungcrypto
19
https:// www. firstrungcrypto.com
com
516
fjldd.com
fjldd.com
fjldd
9
https:// www. fjldd.com
com
517
fityantra.com
fityantra.com
fityantra
13
https:// www. fityantra.com
com
518
fuzhouxisu.com
fuzhouxisu.com
fuzhouxisu
14
https:// www. fuzhouxisu.com
com
519
foodindustryena.com
foodindustryena.com
foodindustryena
19
https:// www. foodindustryena.com
com
520
farfetchs.com
farfetchs.com
farfetchs
13
https:// www. farfetchs.com
com
521
fitdoula.com
fitdoula.com
fitdoula
12
https:// www. fitdoula.com
com
522
fit-ergysport.com
fit-ergysport.com
fit-ergysport
17
https:// www. fit-ergysport.com
com
523
footbodyguard.com
footbodyguard.com
footbodyguard
17
https:// www. footbodyguard.com
com
524
figuredeal.com
figuredeal.com
figuredeal
14
https:// www. figuredeal.com
com
525
fineartichoke.com
fineartichoke.com
fineartichoke
17
https:// www. fineartichoke.com
com
526
fpinfra.com
fpinfra.com
fpinfra
11
https:// www. fpinfra.com
com
527
formothersatkaust.com
formothersatkaust.com
formothersatkaust
21
https:// www. formothersatkaust.com
com
528
familydq.com
familydq.com
familydq
12
https:// www. familydq.com
com
529
frontierspinining.com
frontierspinining.com
frontierspinining
21
https:// www. frontierspinining.com
com
530
fight-society.com
fight-society.com
fight-society
17
https:// www. fight-society.com
com
531
foxtau.com
foxtau.com
foxtau
10
https:// www. foxtau.com
com
532
funachina.com
funachina.com
funachina
13
https:// www. funachina.com
com
533
freshofftheboatvintage.com
freshofftheboatvintage.com
freshofftheboatvintage
26
https:// www. freshofftheboatvintage.com
com
534
fbchillsville.com
fbchillsville.com
fbchillsville
17
https:// www. fbchillsville.com
com
535
fysinvestments.com
fysinvestments.com
fysinvestments
18
https:// www. fysinvestments.com
com
536
flormons.com
flormons.com
flormons
12
https:// www. flormons.com
com
537
fastholerunning.com
fastholerunning.com
fastholerunning
19
https:// www. fastholerunning.com
com
538
flm7788.com
flm7788.com
flm7788
11
https:// www. flm7788.com
com
539
fc-bb9uhk5hbw.com
fc-bb9uhk5hbw.com
fc-bb9uhk5hbw
17
https:// www. fc-bb9uhk5hbw.com
com
540
freshofout***s.com
freshofout***s.com
freshofoutfucks
19
https:// www. freshofout***s.com
com
541
fwyjj.com
fwyjj.com
fwyjj
9
https:// www. fwyjj.com
com
542
fitness-w.com
fitness-w.com
fitness-w
13
https:// www. fitness-w.com
com
543
femdecs.com
femdecs.com
femdecs
11
https:// www. femdecs.com
com
544
floretteskincare.com
floretteskincare.com
floretteskincare
20
https:// www. floretteskincare.com
com
545
fujiahealth.com
fujiahealth.com
fujiahealth
15
https:// www. fujiahealth.com
com
546
federalnewsrado.com
federalnewsrado.com
federalnewsrado
19
https:// www. federalnewsrado.com
com
547
fastrealestatesales.com
fastrealestatesales.com
fastrealestatesales
23
https:// www. fastrealestatesales.com
com
548
funnyx10.com
funnyx10.com
funnyx10
12
https:// www. funnyx10.com
com
549
fdcyq8.com
fdcyq8.com
fdcyq8
10
https:// www. fdcyq8.com
com
550
falconpreview.com
falconpreview.com
falconpreview
17
https:// www. falconpreview.com
com
551
foriegnautoimports.com
foriegnautoimports.com
foriegnautoimports
22
https:// www. foriegnautoimports.com
com
552
fo3ir.com
fo3ir.com
fo3ir
9
https:// www. fo3ir.com
com
553
foxsoirts.com
foxsoirts.com
foxsoirts
13
https:// www. foxsoirts.com
com
554
foodvanman.com
foodvanman.com
foodvanman
14
https:// www. foodvanman.com
com
555
footballprocoaching.com
footballprocoaching.com
footballprocoaching
23
https:// www. footballprocoaching.com
com
556
fireupusa.com
fireupusa.com
fireupusa
13
https:// www. fireupusa.com
com
557
fiosvw.com
fiosvw.com
fiosvw
10
https:// www. fiosvw.com
com
558
facemcgee.com
facemcgee.com
facemcgee
13
https:// www. facemcgee.com
com
559
farizchowdhury.com
farizchowdhury.com
farizchowdhury
18
https:// www. farizchowdhury.com
com
560
fullbul.com
fullbul.com
fullbul
11
https:// www. fullbul.com
com
561
freyjaha.com
freyjaha.com
freyjaha
12
https:// www. freyjaha.com
com
562
fakenewspersonalityroftheyear.com
fakenewspersonalityroftheyear.com
fakenewspersonalityroftheyear
33
https:// www. fakenewspersonalityroftheyear.com
com
563
fitnessmoneyclub.com
fitnessmoneyclub.com
fitnessmoneyclub
20
https:// www. fitnessmoneyclub.com
com
564
fluffytots.com
fluffytots.com
fluffytots
14
https:// www. fluffytots.com
com
565
familybotanicalcompany.com
familybotanicalcompany.com
familybotanicalcompany
26
https:// www. familybotanicalcompany.com
com
566
factassist.com
factassist.com
factassist
14
https:// www. factassist.com
com
567
funkclone.com
funkclone.com
funkclone
13
https:// www. funkclone.com
com
568
fillrealestate.com
fillrealestate.com
fillrealestate
18
https:// www. fillrealestate.com
com
569
fujikin-usa.com
fujikin-usa.com
fujikin-usa
15
https:// www. fujikin-usa.com
com
570
finachic.com
finachic.com
finachic
12
https:// www. finachic.com
com
571
files-castle.com
files-castle.com
files-castle
16
https:// www. files-castle.com
com
572
fi2mi.com
fi2mi.com
fi2mi
9
https:// www. fi2mi.com
com
573
felicialachellesboutique.com
felicialachellesboutique.com
felicialachellesboutique
28
https:// www. felicialachellesboutique.com
com
574
fqcl666.com
fqcl666.com
fqcl666
11
https:// www. fqcl666.com
com
575
flooringcampbell.com
flooringcampbell.com
flooringcampbell
20
https:// www. flooringcampbell.com
com
576
fitrat.com
fitrat.com
fitrat
10
https:// www. fitrat.com
com
577
fillproperty.com
fillproperty.com
fillproperty
16
https:// www. fillproperty.com
com
578
floorcleaningjacksonville.com
floorcleaningjacksonville.com
floorcleaningjacksonville
29
https:// www. floorcleaningjacksonville.com
com
579
fannysfurniturekelowna.com
fannysfurniturekelowna.com
fannysfurniturekelowna
26
https:// www. fannysfurniturekelowna.com
com
580
fpkj199.com
fpkj199.com
fpkj199
11
https:// www. fpkj199.com
com
581
fortunefindersinc.com
fortunefindersinc.com
fortunefindersinc
21
https:// www. fortunefindersinc.com
com
582
foxfarmnursery.com
foxfarmnursery.com
foxfarmnursery
18
https:// www. foxfarmnursery.com
com
583
firezz.com
firezz.com
firezz
10
https:// www. firezz.com
com
584
findingikigaii.com
findingikigaii.com
findingikigaii
18
https:// www. findingikigaii.com
com
585
fairytaledates.com
fairytaledates.com
fairytaledates
18
https:// www. fairytaledates.com
com
586
fishydesigns.com
fishydesigns.com
fishydesigns
16
https:// www. fishydesigns.com
com
587
fashionshopks.com
fashionshopks.com
fashionshopks
17
https:// www. fashionshopks.com
com
588
funnysauce.com
funnysauce.com
funnysauce
14
https:// www. funnysauce.com
com
589
fienon.com
fienon.com
fienon
10
https:// www. fienon.com
com
590
fxorange.com
fxorange.com
fxorange
12
https:// www. fxorange.com
com
591
foresightquality.com
foresightquality.com
foresightquality
20
https:// www. foresightquality.com
com
592
fongleng.com
fongleng.com
fongleng
12
https:// www. fongleng.com
com
593
fluffyrufflesboutique.com
fluffyrufflesboutique.com
fluffyrufflesboutique
25
https:// www. fluffyrufflesboutique.com
com
594
funtastespain.com
funtastespain.com
funtastespain
17
https:// www. funtastespain.com
com
595
face2table.com
face2table.com
face2table
14
https:// www. face2table.com
com
596
forexkon.com
forexkon.com
forexkon
12
https:// www. forexkon.com
com
597
francishascheaphomes.com
francishascheaphomes.com
francishascheaphomes
24
https:// www. francishascheaphomes.com
com
598
fabbylists.com
fabbylists.com
fabbylists
14
https:// www. fabbylists.com
com
599
finghers.com
finghers.com
finghers
12
https:// www. finghers.com
com
600
fdacs-cannabis.com
fdacs-cannabis.com
fdacs-cannabis
18
https:// www. fdacs-cannabis.com
com
601
franciscoresendiz.com
franciscoresendiz.com
franciscoresendiz
21
https:// www. franciscoresendiz.com
com
602
fairfaxcosmeticsurgery.com
fairfaxcosmeticsurgery.com
fairfaxcosmeticsurgery
26
https:// www. fairfaxcosmeticsurgery.com
com
603
faithembracesfear.com
faithembracesfear.com
faithembracesfear
21
https:// www. faithembracesfear.com
com
604
ffqq6789.com
ffqq6789.com
ffqq6789
12
https:// www. ffqq6789.com
com
605
fbdjj.com
fbdjj.com
fbdjj
9
https:// www. fbdjj.com
com
606
funbookmarking.com
funbookmarking.com
funbookmarking
18
https:// www. funbookmarking.com
com
607
floatingfolks.com
floatingfolks.com
floatingfolks
17
https:// www. floatingfolks.com
com
608
freres-et-soeurs.com
freres-et-soeurs.com
freres-et-soeurs
20
https:// www. freres-et-soeurs.com
com
609
flitrosguadalajara.com
flitrosguadalajara.com
flitrosguadalajara
22
https:// www. flitrosguadalajara.com
com
610
fun-life-info.com
fun-life-info.com
fun-life-info
17
https:// www. fun-life-info.com
com
611
filtersvacuum.com
filtersvacuum.com
filtersvacuum
17
https:// www. filtersvacuum.com
com
612
frenchbulldog-sanfrancisco.com
frenchbulldog-sanfrancisco.com
frenchbulldog-sanfrancisco
30
https:// www. frenchbulldog-sanfrancisco.com
com
613
freemax360.com
freemax360.com
freemax360
14
https:// www. freemax360.com
com
614
firfold.com
firfold.com
firfold
11
https:// www. firfold.com
com
615
fun-teng.com
fun-teng.com
fun-teng
12
https:// www. fun-teng.com
com
616
fsshuo.com
fsshuo.com
fsshuo
10
https:// www. fsshuo.com
com
617
farmerknee.com
farmerknee.com
farmerknee
14
https:// www. farmerknee.com
com
618
fruitshades.com
fruitshades.com
fruitshades
15
https:// www. fruitshades.com
com
619
forkonomy.com
forkonomy.com
forkonomy
13
https:// www. forkonomy.com
com
620
fwengyl.com
fwengyl.com
fwengyl
11
https:// www. fwengyl.com
com
621
fitnesszonedesk.com
fitnesszonedesk.com
fitnesszonedesk
19
https:// www. fitnesszonedesk.com
com
622
fjdak.com
fjdak.com
fjdak
9
https:// www. fjdak.com
com
623
forevergasque.com
forevergasque.com
forevergasque
17
https:// www. forevergasque.com
com
624
fideliascare.com
fideliascare.com
fideliascare
16
https:// www. fideliascare.com
com
625
franespejo.com
franespejo.com
franespejo
14
https:// www. franespejo.com
com
626
firstbilingualprep.com
firstbilingualprep.com
firstbilingualprep
22
https:// www. firstbilingualprep.com
com
627
firstbead.com
firstbead.com
firstbead
13
https:// www. firstbead.com
com
628
frenchmgmt.com
frenchmgmt.com
frenchmgmt
14
https:// www. frenchmgmt.com
com
629
fadacailiuliu7.com
fadacailiuliu7.com
fadacailiuliu7
18
https:// www. fadacailiuliu7.com
com
630
foodisnotafight.com
foodisnotafight.com
foodisnotafight
19
https:// www. foodisnotafight.com
com
631
fortifiedink.com
fortifiedink.com
fortifiedink
16
https:// www. fortifiedink.com
com
632
fivetofeelalive.com
fivetofeelalive.com
fivetofeelalive
19
https:// www. fivetofeelalive.com
com
633
fullmovienew.com
fullmovienew.com
fullmovienew
16
https:// www. fullmovienew.com
com
634
felloffdatruck.com
felloffdatruck.com
felloffdatruck
18
https:// www. felloffdatruck.com
com
635
foodtruckroute.com
foodtruckroute.com
foodtruckroute
18
https:// www. foodtruckroute.com
com
636
foglebags.com
foglebags.com
foglebags
13
https:// www. foglebags.com
com
637
feedachildevents.com
feedachildevents.com
feedachildevents
20
https:// www. feedachildevents.com
com
638
flosight.com
flosight.com
flosight
12
https:// www. flosight.com
com
639
futureeyeeartificialintelligence.com
futureeyeeartificialintelligence.com
futureeyeeartificialintelligence
36
https:// www. futureeyeeartificialintelligence.com
com
640
figuredeals.com
figuredeals.com
figuredeals
15
https:// www. figuredeals.com
com
641
fsmaweebly.com
fsmaweebly.com
fsmaweebly
14
https:// www. fsmaweebly.com
com
642
funakura-seikotsu.com
funakura-seikotsu.com
funakura-seikotsu
21
https:// www. funakura-seikotsu.com
com
643
fourloughcheesecake.com
fourloughcheesecake.com
fourloughcheesecake
23
https:// www. fourloughcheesecake.com
com
644
fetishfashionawards.com
fetishfashionawards.com
fetishfashionawards
23
https:// www. fetishfashionawards.com
com
645
freehostingtrust.com
freehostingtrust.com
freehostingtrust
20
https:// www. freehostingtrust.com
com
646
fbcgglenarden.com
fbcgglenarden.com
fbcgglenarden
17
https:// www. fbcgglenarden.com
com
647
flc-home.com
flc-home.com
flc-home
12
https:// www. flc-home.com
com
648
flushingfoo.com
flushingfoo.com
flushingfoo
15
https:// www. flushingfoo.com
com
649
floridainternationaltravelexpo.com
floridainternationaltravelexpo.com
floridainternationaltravelexpo
34
https:// www. floridainternationaltravelexpo.com
com
650
friendlyfin.com
friendlyfin.com
friendlyfin
15
https:// www. friendlyfin.com
com
651
fluahingbank.com
fluahingbank.com
fluahingbank
16
https:// www. fluahingbank.com
com
652
freenewsz.com
freenewsz.com
freenewsz
13
https:// www. freenewsz.com
com
653
fabricdirectblog.com
fabricdirectblog.com
fabricdirectblog
20
https:// www. fabricdirectblog.com
com
654
forexprospect.com
forexprospect.com
forexprospect
17
https:// www. forexprospect.com
com
655
floodprotectionmadesimple.com
floodprotectionmadesimple.com
floodprotectionmadesimple
29
https:// www. floodprotectionmadesimple.com
com
656
flurofun.com
flurofun.com
flurofun
12
https:// www. flurofun.com
com
657
fireuplife.com
fireuplife.com
fireuplife
14
https:// www. fireuplife.com
com
658
fancyloves.com
fancyloves.com
fancyloves
14
https:// www. fancyloves.com
com
659
faithresults.com
faithresults.com
faithresults
16
https:// www. faithresults.com
com
660
felizsigloxxi.com
felizsigloxxi.com
felizsigloxxi
17
https:// www. felizsigloxxi.com
com
661
flete-seguro.com
flete-seguro.com
flete-seguro
16
https:// www. flete-seguro.com
com
662
friendsofkirkleyhall.com
friendsofkirkleyhall.com
friendsofkirkleyhall
24
https:// www. friendsofkirkleyhall.com
com
663
fx160.com
fx160.com
fx160
9
https:// www. fx160.com
com
664
firesidefamily.com
firesidefamily.com
firesidefamily
18
https:// www. firesidefamily.com
com
665
fleksitariskmat.com
fleksitariskmat.com
fleksitariskmat
19
https:// www. fleksitariskmat.com
com
666
fangrongid.com
fangrongid.com
fangrongid
14
https:// www. fangrongid.com
com
667
ferramentaskenedy.com
ferramentaskenedy.com
ferramentaskenedy
21
https:// www. ferramentaskenedy.com
com
668
fireweedfloral.com
fireweedfloral.com
fireweedfloral
18
https:// www. fireweedfloral.com
com
669
freegamesunity.com
freegamesunity.com
freegamesunity
18
https:// www. freegamesunity.com
com
670
fujakurniawan.com
fujakurniawan.com
fujakurniawan
17
https:// www. fujakurniawan.com
com
671
fernandomorenojr.com
fernandomorenojr.com
fernandomorenojr
20
https:// www. fernandomorenojr.com
com
672
foreclosureemergency.com
foreclosureemergency.com
foreclosureemergency
24
https:// www. foreclosureemergency.com
com
673
fotocostantini.com
fotocostantini.com
fotocostantini
18
https:// www. fotocostantini.com
com
674
fillplays.com
fillplays.com
fillplays
13
https:// www. fillplays.com
com
675
fitexpertone.com
fitexpertone.com
fitexpertone
16
https:// www. fitexpertone.com
com
676
fortnightworlds.com
fortnightworlds.com
fortnightworlds
19
https:// www. fortnightworlds.com
com
677
fahrtalent.com
fahrtalent.com
fahrtalent
14
https:// www. fahrtalent.com
com
678
flikzer.com
flikzer.com
flikzer
11
https:// www. flikzer.com
com
679
fill***.com
fill***.com
fillsex
11
https:// www. fill***.com
com
680
fifa19freebies.com
fifa19freebies.com
fifa19freebies
18
https:// www. fifa19freebies.com
com
681
florrieandboo.com
florrieandboo.com
florrieandboo
17
https:// www. florrieandboo.com
com
682
franceappeler.com
franceappeler.com
franceappeler
17
https:// www. franceappeler.com
com
683
freelancefemmes.com
freelancefemmes.com
freelancefemmes
19
https:// www. freelancefemmes.com
com
684
funnyyoushouldasktv.com
funnyyoushouldasktv.com
funnyyoushouldasktv
23
https:// www. funnyyoushouldasktv.com
com
685
fomaska.com
fomaska.com
fomaska
11
https:// www. fomaska.com
com
686
firsttouchsd.com
firsttouchsd.com
firsttouchsd
16
https:// www. firsttouchsd.com
com
687
fachschaft24.com
fachschaft24.com
fachschaft24
16
https:// www. fachschaft24.com
com
688
fortvuck.com
fortvuck.com
fortvuck
12
https:// www. fortvuck.com
com
689
florxpress.com
florxpress.com
florxpress
14
https:// www. florxpress.com
com
690
futureindiapay.com
futureindiapay.com
futureindiapay
18
https:// www. futureindiapay.com
com
691
fireveg.com
fireveg.com
fireveg
11
https:// www. fireveg.com
com
692
flyyuyan.com
flyyuyan.com
flyyuyan
12
https:// www. flyyuyan.com
com
693
fourmea.com
fourmea.com
fourmea
11
https:// www. fourmea.com
com
694
filmautotech.com
filmautotech.com
filmautotech
16
https:// www. filmautotech.com
com
695
foyerrealty.com
foyerrealty.com
foyerrealty
15
https:// www. foyerrealty.com
com
696
freeonlinepaper.com
freeonlinepaper.com
freeonlinepaper
19
https:// www. freeonlinepaper.com
com
697
flowergirlsandmore.com
flowergirlsandmore.com
flowergirlsandmore
22
https:// www. flowergirlsandmore.com
com
698
faststartcareers.com
faststartcareers.com
faststartcareers
20
https:// www. faststartcareers.com
com
699
fujiadata.com
fujiadata.com
fujiadata
13
https:// www. fujiadata.com
com
700
fpsmy.com
fpsmy.com
fpsmy
9
https:// www. fpsmy.com
com
701
freeibookstemplates.com
freeibookstemplates.com
freeibookstemplates
23
https:// www. freeibookstemplates.com
com
702
fourdublin.com
fourdublin.com
fourdublin
14
https:// www. fourdublin.com
com
703
foeg4ng.com
foeg4ng.com
foeg4ng
11
https:// www. foeg4ng.com
com
704
frequencyofprovision.com
frequencyofprovision.com
frequencyofprovision
24
https:// www. frequencyofprovision.com
com
705
f7a5lv.com
f7a5lv.com
f7a5lv
10
https:// www. f7a5lv.com
com
706
fxfjj.com
fxfjj.com
fxfjj
9
https:// www. fxfjj.com
com
707
finishyourgreens.com
finishyourgreens.com
finishyourgreens
20
https:// www. finishyourgreens.com
com
708
fltonbank.com
fltonbank.com
fltonbank
13
https:// www. fltonbank.com
com
709
fernando-store.com
fernando-store.com
fernando-store
18
https:// www. fernando-store.com
com
710
fxtplatform.com
fxtplatform.com
fxtplatform
15
https:// www. fxtplatform.com
com
711
fitvulva.com
fitvulva.com
fitvulva
12
https:// www. fitvulva.com
com
712
flippitydippity.com
flippitydippity.com
flippitydippity
19
https:// www. flippitydippity.com
com
713
fliincus.com
fliincus.com
fliincus
12
https:// www. fliincus.com
com
714
ffff520.com
ffff520.com
ffff520
11
https:// www. ffff520.com
com
715
forbiddencherry.com
forbiddencherry.com
forbiddencherry
19
https:// www. forbiddencherry.com
com
716
freesehomeinspections.com
freesehomeinspections.com
freesehomeinspections
25
https:// www. freesehomeinspections.com
com
717
forodelseo.com
forodelseo.com
forodelseo
14
https:// www. forodelseo.com
com
718
flushingdating.com
flushingdating.com
flushingdating
18
https:// www. flushingdating.com
com
719
fortinetperu.com
fortinetperu.com
fortinetperu
16
https:// www. fortinetperu.com
com
720
fringefinance.com
fringefinance.com
fringefinance
17
https:// www. fringefinance.com
com
721
fensemao.com
fensemao.com
fensemao
12
https:// www. fensemao.com
com
722
firstsavingss.com
firstsavingss.com
firstsavingss
17
https:// www. firstsavingss.com
com
723
fundsaccntsolutions.com
fundsaccntsolutions.com
fundsaccntsolutions
23
https:// www. fundsaccntsolutions.com
com
724
fredbergerdesignandbuild.com
fredbergerdesignandbuild.com
fredbergerdesignandbuild
28
https:// www. fredbergerdesignandbuild.com
com
725
fitomart.com
fitomart.com
fitomart
12
https:// www. fitomart.com
com
726
findlovematchmaking.com
findlovematchmaking.com
findlovematchmaking
23
https:// www. findlovematchmaking.com
com
727
flck3.com
flck3.com
flck3
9
https:// www. flck3.com
com
728
fastcashoffernc.com
fastcashoffernc.com
fastcashoffernc
19
https:// www. fastcashoffernc.com
com
729
fwykw.com
fwykw.com
fwykw
9
https:// www. fwykw.com
com
730
fastfirerecords.com
fastfirerecords.com
fastfirerecords
19
https:// www. fastfirerecords.com
com
731
fingsavage.com
fingsavage.com
fingsavage
14
https:// www. fingsavage.com
com
732
fireproofhousing.com
fireproofhousing.com
fireproofhousing
20
https:// www. fireproofhousing.com
com
733
fyscf.com
fyscf.com
fyscf
9
https:// www. fyscf.com
com
734
fittoflush.com
fittoflush.com
fittoflush
14
https:// www. fittoflush.com
com
735
fewoluedenscheid.com
fewoluedenscheid.com
fewoluedenscheid
20
https:// www. fewoluedenscheid.com
com
736
fittrainerworld.com
fittrainerworld.com
fittrainerworld
19
https:// www. fittrainerworld.com
com
737
fundamentaltoys.com
fundamentaltoys.com
fundamentaltoys
19
https:// www. fundamentaltoys.com
com
738
fernandonatalici.com
fernandonatalici.com
fernandonatalici
20
https:// www. fernandonatalici.com
com
739
freerealestatemoney.com
freerealestatemoney.com
freerealestatemoney
23
https:// www. freerealestatemoney.com
com
740
flugel-photobooks.com
flugel-photobooks.com
flugel-photobooks
21
https:// www. flugel-photobooks.com
com
741
fqsina.com
fqsina.com
fqsina
10
https:// www. fqsina.com
com
742
fhjgjhdfkjds.com
fhjgjhdfkjds.com
fhjgjhdfkjds
16
https:// www. fhjgjhdfkjds.com
com
743
fyiinvestigator.com
fyiinvestigator.com
fyiinvestigator
19
https:// www. fyiinvestigator.com
com
744
flightcloser.com
flightcloser.com
flightcloser
16
https:// www. flightcloser.com
com
745
fourchee.com
fourchee.com
fourchee
12
https:// www. fourchee.com
com
746
freedomcyclist.com
freedomcyclist.com
freedomcyclist
18
https:// www. freedomcyclist.com
com
747
fscbm.com
fscbm.com
fscbm
9
https:// www. fscbm.com
com
748
fullcircledivorceassistance.com
fullcircledivorceassistance.com
fullcircledivorceassistance
31
https:// www. fullcircledivorceassistance.com
com
749
fayxsm.com
fayxsm.com
fayxsm
10
https:// www. fayxsm.com
com
750
fitfedclub.com
fitfedclub.com
fitfedclub
14
https:// www. fitfedclub.com
com
751
fabjt.com
fabjt.com
fabjt
9
https:// www. fabjt.com
com
752
funnelsapp.com
funnelsapp.com
funnelsapp
14
https:// www. funnelsapp.com
com
753
forgemontana.com
forgemontana.com
forgemontana
16
https:// www. forgemontana.com
com
754
fozziesfuzzies.com
fozziesfuzzies.com
fozziesfuzzies
18
https:// www. fozziesfuzzies.com
com
755
fkzj84.com
fkzj84.com
fkzj84
10
https:// www. fkzj84.com
com
756
farnivest.com
farnivest.com
farnivest
13
https:// www. farnivest.com
com
757
firstbaptistsouthhill.com
firstbaptistsouthhill.com
firstbaptistsouthhill
25
https:// www. firstbaptistsouthhill.com
com
758
flotyn.com
flotyn.com
flotyn
10
https:// www. flotyn.com
com
759
fubicai.com
fubicai.com
fubicai
11
https:// www. fubicai.com
com
760
flpbywalter.com
flpbywalter.com
flpbywalter
15
https:// www. flpbywalter.com
com
761
fifty6marketing.com
fifty6marketing.com
fifty6marketing
19
https:// www. fifty6marketing.com
com
762
feigseoa.com
feigseoa.com
feigseoa
12
https:// www. feigseoa.com
com
763
figurewood.com
figurewood.com
figurewood
14
https:// www. figurewood.com
com
764
fraifrais.com
fraifrais.com
fraifrais
13
https:// www. fraifrais.com
com
765
foreverhjs.com
foreverhjs.com
foreverhjs
14
https:// www. foreverhjs.com
com
766
foodinspirasi.com
foodinspirasi.com
foodinspirasi
17
https:// www. foodinspirasi.com
com
767
fatehjangmart.com
fatehjangmart.com
fatehjangmart
17
https:// www. fatehjangmart.com
com
768
fngigz.com
fngigz.com
fngigz
10
https:// www. fngigz.com
com
769
feetassist.com
feetassist.com
feetassist
14
https:// www. feetassist.com
com
770
fortsaskatchewaninsurance.com
fortsaskatchewaninsurance.com
fortsaskatchewaninsurance
29
https:// www. fortsaskatchewaninsurance.com
com
771
finisity.com
finisity.com
finisity
12
https:// www. finisity.com
com
772
forbiddensnack.com
forbiddensnack.com
forbiddensnack
18
https:// www. forbiddensnack.com
com
773
fieldstein.com
fieldstein.com
fieldstein
14
https:// www. fieldstein.com
com
774
fletesymudanzaswl.com
fletesymudanzaswl.com
fletesymudanzaswl
21
https:// www. fletesymudanzaswl.com
com
775
floridalandassociates.com
floridalandassociates.com
floridalandassociates
25
https:// www. floridalandassociates.com
com
776
flordiageorgialine.com
flordiageorgialine.com
flordiageorgialine
22
https:// www. flordiageorgialine.com
com
777
fatecore.com
fatecore.com
fatecore
12
https:// www. fatecore.com
com
778
fgxbgr.com
fgxbgr.com
fgxbgr
10
https:// www. fgxbgr.com
com
779
fosteredlove.com
fosteredlove.com
fosteredlove
16
https:// www. fosteredlove.com
com
780
fthsd.com
fthsd.com
fthsd
9
https:// www. fthsd.com
com
781
fivetrader.com
fivetrader.com
fivetrader
14
https:// www. fivetrader.com
com
782
fkpfhzj.com
fkpfhzj.com
fkpfhzj
11
https:// www. fkpfhzj.com
com
783
fortune-g-hk.com
fortune-g-hk.com
fortune-g-hk
16
https:// www. fortune-g-hk.com
com
784
fordfanhalloffame.com
fordfanhalloffame.com
fordfanhalloffame
21
https:// www. fordfanhalloffame.com
com
785
findyouraloha.com
findyouraloha.com
findyouraloha
17
https:// www. findyouraloha.com
com
786
fairhavenband.com
fairhavenband.com
fairhavenband
17
https:// www. fairhavenband.com
com
787
feedbackcaller.com
feedbackcaller.com
feedbackcaller
18
https:// www. feedbackcaller.com
com
788
freelikers.com
freelikers.com
freelikers
14
https:// www. freelikers.com
com
789
feitong2008.com
feitong2008.com
feitong2008
15
https:// www. feitong2008.com
com
790
flatshareseries.com
flatshareseries.com
flatshareseries
19
https:// www. flatshareseries.com
com
791
fanryes.com
fanryes.com
fanryes
11
https:// www. fanryes.com
com
792
fillbars.com
fillbars.com
fillbars
12
https:// www. fillbars.com
com
793
fqbsc.com
fqbsc.com
fqbsc
9
https:// www. fqbsc.com
com
794
firstsbankcard.com
firstsbankcard.com
firstsbankcard
18
https:// www. firstsbankcard.com
com
795
felixbacik.com
felixbacik.com
felixbacik
14
https:// www. felixbacik.com
com
796
fdacs-hemp.com
fdacs-hemp.com
fdacs-hemp
14
https:// www. fdacs-hemp.com
com
797
feontgate.com
feontgate.com
feontgate
13
https:// www. feontgate.com
com
798
fllowze.com
fllowze.com
fllowze
11
https:// www. fllowze.com
com
799
floridatheseries.com
floridatheseries.com
floridatheseries
20
https:// www. floridatheseries.com
com
800
feihuanyule.com
feihuanyule.com
feihuanyule
15
https:// www. feihuanyule.com
com
801
foreigndomesticworkersassociationofamerica.com
foreigndomesticworkersassociationofamerica.com
foreigndomesticworkersassociationofamerica
46
https:// www. foreigndomesticworkersassociationofamerica.com
com
802
fruitvegetablesupplements.com
fruitvegetablesupplements.com
fruitvegetablesupplements
29
https:// www. fruitvegetablesupplements.com
com
803
free-fitting-room.com
free-fitting-room.com
free-fitting-room
21
https:// www. free-fitting-room.com
com
804
fitnessbootcampaustin.com
fitnessbootcampaustin.com
fitnessbootcampaustin
25
https:// www. fitnessbootcampaustin.com
com
805
forexbotplus.com
forexbotplus.com
forexbotplus
16
https:// www. forexbotplus.com
com
806
freeonlinepennyslotsforfree.com
freeonlinepennyslotsforfree.com
freeonlinepennyslotsforfree
31
https:// www. freeonlinepennyslotsforfree.com
com
807
florencejosh.com
florencejosh.com
florencejosh
16
https:// www. florencejosh.com
com
808
fllory.com
fllory.com
fllory
10
https:// www. fllory.com
com
809
flamingoautotransport.com
flamingoautotransport.com
flamingoautotransport
25
https:// www. flamingoautotransport.com
com
810
footselect.com
footselect.com
footselect
14
https:// www. footselect.com
com
811
floridahomemortgageloans.com
floridahomemortgageloans.com
floridahomemortgageloans
28
https:// www. floridahomemortgageloans.com
com
812
fugeit.com
fugeit.com
fugeit
10
https:// www. fugeit.com
com
813
fz-111.com
fz-111.com
fz-111
10
https:// www. fz-111.com
com
814
foxfinecarpentry.com
foxfinecarpentry.com
foxfinecarpentry
20
https:// www. foxfinecarpentry.com
com
815
frstnews.com
frstnews.com
frstnews
12
https:// www. frstnews.com
com
816
fellnew.com
fellnew.com
fellnew
11
https:// www. fellnew.com
com
817
fm12315.com
fm12315.com
fm12315
11
https:// www. fm12315.com
com
818
faithesis.com
faithesis.com
faithesis
13
https:// www. faithesis.com
com
819
following-garyvee.com
following-garyvee.com
following-garyvee
21
https:// www. following-garyvee.com
com
820
foot-stuff.com
foot-stuff.com
foot-stuff
14
https:// www. foot-stuff.com
com
821
fredericskburgrestaurantweek.com
fredericskburgrestaurantweek.com
fredericskburgrestaurantweek
32
https:// www. fredericskburgrestaurantweek.com
com
822
forwardgravel.com
forwardgravel.com
forwardgravel
17
https:// www. forwardgravel.com
com
823
forwardinghelp.com
forwardinghelp.com
forwardinghelp
18
https:// www. forwardinghelp.com
com
824
fillplane.com
fillplane.com
fillplane
13
https:// www. fillplane.com
com
825
fishinggreatlakes.com
fishinggreatlakes.com
fishinggreatlakes
21
https:// www. fishinggreatlakes.com
com
826
fjpj559w3wuz6.com
fjpj559w3wuz6.com
fjpj559w3wuz6
17
https:// www. fjpj559w3wuz6.com
com
827
fortressraid.com
fortressraid.com
fortressraid
16
https:// www. fortressraid.com
com
828
freecreditscore2go.com
freecreditscore2go.com
freecreditscore2go
22
https:// www. freecreditscore2go.com
com
829
ferherty.com
ferherty.com
ferherty
12
https:// www. ferherty.com
com
830
fsfous.com
fsfous.com
fsfous
10
https:// www. fsfous.com
com
831
fz-222.com
fz-222.com
fz-222
10
https:// www. fz-222.com
com
832
fanatic-okayama.com
fanatic-okayama.com
fanatic-okayama
19
https:// www. fanatic-okayama.com
com
833
fabfw.com
fabfw.com
fabfw
9
https:// www. fabfw.com
com
834
fallenlemmings.com
fallenlemmings.com
fallenlemmings
18
https:// www. fallenlemmings.com
com
835
freesunglassesonline.com
freesunglassesonline.com
freesunglassesonline
24
https:// www. freesunglassesonline.com
com
836
fakepsot.com
fakepsot.com
fakepsot
12
https:// www. fakepsot.com
com
837
fortierboatsinc.com
fortierboatsinc.com
fortierboatsinc
19
https:// www. fortierboatsinc.com
com
838
flashforwardevents.com
flashforwardevents.com
flashforwardevents
22
https:// www. flashforwardevents.com
com
839
fianceexpress.com
fianceexpress.com
fianceexpress
17
https:// www. fianceexpress.com
com
840
fithealthybest.com
fithealthybest.com
fithealthybest
18
https:// www. fithealthybest.com
com
841
fragrentjewles.com
fragrentjewles.com
fragrentjewles
18
https:// www. fragrentjewles.com
com
842
floydbrownmusic.com
floydbrownmusic.com
floydbrownmusic
19
https:// www. floydbrownmusic.com
com
843
fsgholding.com
fsgholding.com
fsgholding
14
https:// www. fsgholding.com
com
844
forexorpro.com
forexorpro.com
forexorpro
14
https:// www. forexorpro.com
com
845
fithappyherbivore.com
fithappyherbivore.com
fithappyherbivore
21
https:// www. fithappyherbivore.com
com
846
foryourpreciouspet.com
foryourpreciouspet.com
foryourpreciouspet
22
https:// www. foryourpreciouspet.com
com
847
f74ypb.com
f74ypb.com
f74ypb
10
https:// www. f74ypb.com
com
848
falconsneakpeek.com
falconsneakpeek.com
falconsneakpeek
19
https:// www. falconsneakpeek.com
com
849
fingerscadburysfc.com
fingerscadburysfc.com
fingerscadburysfc
21
https:// www. fingerscadburysfc.com
com
850
fishinghuntinghshow.com
fishinghuntinghshow.com
fishinghuntinghshow
23
https:// www. fishinghuntinghshow.com
com
851
fakrfak.com
fakrfak.com
fakrfak
11
https:// www. fakrfak.com
com
852
fourlinesofcode.com
fourlinesofcode.com
fourlinesofcode
19
https:// www. fourlinesofcode.com
com
853
facthus.com
facthus.com
facthus
11
https:// www. facthus.com
com
854
financialservicesmarketingsimplified.com
financialservicesmarketingsimplified.com
financialservicesmarketingsimplified
40
https:// www. financialservicesmarketingsimplified.com
com
855
frenchriviera-bijoux.com
frenchriviera-bijoux.com
frenchriviera-bijoux
24
https:// www. frenchriviera-bijoux.com
com
856
fabkf.com
fabkf.com
fabkf
9
https:// www. fabkf.com
com
857
farmshaker.com
farmshaker.com
farmshaker
14
https:// www. farmshaker.com
com
858
famoussteaksushi.com
famoussteaksushi.com
famoussteaksushi
20
https:// www. famoussteaksushi.com
com
859
freesupershot.com
freesupershot.com
freesupershot
17
https:// www. freesupershot.com
com
860
figsandpoppies.com
figsandpoppies.com
figsandpoppies
18
https:// www. figsandpoppies.com
com
861
f3000d.com
f3000d.com
f3000d
10
https:// www. f3000d.com
com
862
fastestpony.com
fastestpony.com
fastestpony
15
https:// www. fastestpony.com
com
863
factapi.com
factapi.com
factapi
11
https:// www. factapi.com
com
864
full-cc.com
full-cc.com
full-cc
11
https:// www. full-cc.com
com
865
firsttothekey.com
firsttothekey.com
firsttothekey
17
https:// www. firsttothekey.com
com
866
floridajen.com
floridajen.com
floridajen
14
https:// www. floridajen.com
com
867
ffglobetrotter.com
ffglobetrotter.com
ffglobetrotter
18
https:// www. ffglobetrotter.com
com
868
freeanswerguide.com
freeanswerguide.com
freeanswerguide
19
https:// www. freeanswerguide.com
com
869
flawlessoffers.com
flawlessoffers.com
flawlessoffers
18
https:// www. flawlessoffers.com
com
870
fmoviescab.com
fmoviescab.com
fmoviescab
14
https:// www. fmoviescab.com
com
871
favorp.com
favorp.com
favorp
10
https:// www. favorp.com
com
872
fatimaesanchez.com
fatimaesanchez.com
fatimaesanchez
18
https:// www. fatimaesanchez.com
com
873
fizzedrocks.com
fizzedrocks.com
fizzedrocks
15
https:// www. fizzedrocks.com
com
874
faravarf.com
faravarf.com
faravarf
12
https:// www. faravarf.com
com
875
fascnations.com
fascnations.com
fascnations
15
https:// www. fascnations.com
com
876
fjqhjd.com
fjqhjd.com
fjqhjd
10
https:// www. fjqhjd.com
com
877
flightcentrebuyback.com
flightcentrebuyback.com
flightcentrebuyback
23
https:// www. flightcentrebuyback.com
com
878
fuzhouxww123.com
fuzhouxww123.com
fuzhouxww123
16
https:// www. fuzhouxww123.com
com
879
footballsfield.com
footballsfield.com
footballsfield
18
https:// www. footballsfield.com
com
880
ferienwohnung-mali-losinj.com
ferienwohnung-mali-losinj.com
ferienwohnung-mali-losinj
29
https:// www. ferienwohnung-mali-losinj.com
com
881
famille-roch.com
famille-roch.com
famille-roch
16
https:// www. famille-roch.com
com
882
finishlinestrategies.com
finishlinestrategies.com
finishlinestrategies
24
https:// www. finishlinestrategies.com
com
883
fjqiaodong.com
fjqiaodong.com
fjqiaodong
14
https:// www. fjqiaodong.com
com
884
fitbydrsmith.com
fitbydrsmith.com
fitbydrsmith
16
https:// www. fitbydrsmith.com
com
885
femdomepire.com
femdomepire.com
femdomepire
15
https:// www. femdomepire.com
com
886
fairishgroove.com
fairishgroove.com
fairishgroove
17
https:// www. fairishgroove.com
com
887
fitfirestudios.com
fitfirestudios.com
fitfirestudios
18
https:// www. fitfirestudios.com
com
888
fabnotfat.com
fabnotfat.com
fabnotfat
13
https:// www. fabnotfat.com
com
889
frischfrostservice.com
frischfrostservice.com
frischfrostservice
22
https:// www. frischfrostservice.com
com
890
fonsee.com
fonsee.com
fonsee
10
https:// www. fonsee.com
com
891
financialtwins.com
financialtwins.com
financialtwins
18
https:// www. financialtwins.com
com
892
feritnuhoglu.com
feritnuhoglu.com
feritnuhoglu
16
https:// www. feritnuhoglu.com
com
893
fredeticksburg.com
fredeticksburg.com
fredeticksburg
18
https:// www. fredeticksburg.com
com
894
forgoodmoney.com
forgoodmoney.com
forgoodmoney
16
https:// www. forgoodmoney.com
com
895
frenzyandco.com
frenzyandco.com
frenzyandco
15
https:// www. frenzyandco.com
com
896
fontes-sequana.com
fontes-sequana.com
fontes-sequana
18
https:// www. fontes-sequana.com
com
897
flsmd.com
flsmd.com
flsmd
9
https:// www. flsmd.com
com
898
flaskcall.com
flaskcall.com
flaskcall
13
https:// www. flaskcall.com
com
899
fitontheroad.com
fitontheroad.com
fitontheroad
16
https:// www. fitontheroad.com
com
900
fromthebloc.com
fromthebloc.com
fromthebloc
15
https:// www. fromthebloc.com
com
901
fastfitpt.com
fastfitpt.com
fastfitpt
13
https:// www. fastfitpt.com
com
902
fukenko.com
fukenko.com
fukenko
11
https:// www. fukenko.com
com
903
farhack.com
farhack.com
farhack
11
https:// www. farhack.com
com
904
floridahomepb.com
floridahomepb.com
floridahomepb
17
https:// www. floridahomepb.com
com
905
flippped.com
flippped.com
flippped
12
https:// www. flippped.com
com
906
fujairahrun.com
fujairahrun.com
fujairahrun
15
https:// www. fujairahrun.com
com
907
fadcosplay.com
fadcosplay.com
fadcosplay
14
https:// www. fadcosplay.com
com
908
freetimevalue.com
freetimevalue.com
freetimevalue
17
https:// www. freetimevalue.com
com
909
fitgelmalaysia.com
fitgelmalaysia.com
fitgelmalaysia
18
https:// www. fitgelmalaysia.com
com
910
fanrad.com
fanrad.com
fanrad
10
https:// www. fanrad.com
com
911
fugiwichita.com
fugiwichita.com
fugiwichita
15
https:// www. fugiwichita.com
com
912
fastestponies.com
fastestponies.com
fastestponies
17
https:// www. fastestponies.com
com
913
fashionflatlayz.com
fashionflatlayz.com
fashionflatlayz
19
https:// www. fashionflatlayz.com
com
914
forexgto.com
forexgto.com
forexgto
12
https:// www. forexgto.com
com
915
fibrofitandhealthy.com
fibrofitandhealthy.com
fibrofitandhealthy
22
https:// www. fibrofitandhealthy.com
com
916
fruitshade.com
fruitshade.com
fruitshade
14
https:// www. fruitshade.com
com
917
fireflychaser.com
fireflychaser.com
fireflychaser
17
https:// www. fireflychaser.com
com
918
firetvsticktricks.com
firetvsticktricks.com
firetvsticktricks
21
https:// www. firetvsticktricks.com
com
919
fbcreator.com
fbcreator.com
fbcreator
13
https:// www. fbcreator.com
com
920
flordiaapartmentphotos.com
flordiaapartmentphotos.com
flordiaapartmentphotos
26
https:// www. flordiaapartmentphotos.com
com
921
farmsforum.com
farmsforum.com
farmsforum
14
https:// www. farmsforum.com
com
922
fuli530.com
fuli530.com
fuli530
11
https:// www. fuli530.com
com
923
fabswomgers.com
fabswomgers.com
fabswomgers
15
https:// www. fabswomgers.com
com
924
fordelegate.com
fordelegate.com
fordelegate
15
https:// www. fordelegate.com
com
925
flugplanung.com
flugplanung.com
flugplanung
15
https:// www. flugplanung.com
com
926
fa079.com
fa079.com
fa079
9
https:// www. fa079.com
com
927
freefurnancenj.com
freefurnancenj.com
freefurnancenj
18
https:// www. freefurnancenj.com
com
928
fraumerle.com
fraumerle.com
fraumerle
13
https:// www. fraumerle.com
com
929
f60wy.com
f60wy.com
f60wy
9
https:// www. f60wy.com
com
930
floridainvestorsrealty.com
floridainvestorsrealty.com
floridainvestorsrealty
26
https:// www. floridainvestorsrealty.com
com
931
funlolpics.com
funlolpics.com
funlolpics
14
https:// www. funlolpics.com
com
932
floyd-education.com
floyd-education.com
floyd-education
19
https:// www. floyd-education.com
com
933
fracters.com
fracters.com
fracters
12
https:// www. fracters.com
com
934
fdjhghjhdf.com
fdjhghjhdf.com
fdjhghjhdf
14
https:// www. fdjhghjhdf.com
com
935
fogeloch.com
fogeloch.com
fogeloch
12
https:// www. fogeloch.com
com
936
findinghalcyon.com
findinghalcyon.com
findinghalcyon
18
https:// www. findinghalcyon.com
com
937
forrestersinvestors.com
forrestersinvestors.com
forrestersinvestors
23
https:// www. forrestersinvestors.com
com
938
ffjzb.com
ffjzb.com
ffjzb
9
https:// www. ffjzb.com
com
939
felicegarcia.com
felicegarcia.com
felicegarcia
16
https:// www. felicegarcia.com
com
940
fourling.com
fourling.com
fourling
12
https:// www. fourling.com
com
941
flcashbuy.com
flcashbuy.com
flcashbuy
13
https:// www. flcashbuy.com
com
942
fillcamp.com
fillcamp.com
fillcamp
12
https:// www. fillcamp.com
com
943
ferraraforcongress.com
ferraraforcongress.com
ferraraforcongress
22
https:// www. ferraraforcongress.com
com
944
ferreyrolaundryservice.com
ferreyrolaundryservice.com
ferreyrolaundryservice
26
https:// www. ferreyrolaundryservice.com
com
945
fitolity.com
fitolity.com
fitolity
12
https:// www. fitolity.com
com
946
fabulashz.com
fabulashz.com
fabulashz
13
https:// www. fabulashz.com
com
947
fhacreditrequirements.com
fhacreditrequirements.com
fhacreditrequirements
25
https:// www. fhacreditrequirements.com
com
948
fourcreek.com
fourcreek.com
fourcreek
13
https:// www. fourcreek.com
com
949
filtervacuum.com
filtervacuum.com
filtervacuum
16
https:// www. filtervacuum.com
com
950
fbbjy.com
fbbjy.com
fbbjy
9
https:// www. fbbjy.com
com
951
funnyrc.com
funnyrc.com
funnyrc
11
https:// www. funnyrc.com
com
952
fzgljd.com
fzgljd.com
fzgljd
10
https:// www. fzgljd.com
com
953
faqos.com
faqos.com
faqos
9
https:// www. faqos.com
com
954
finforensicsja.com
finforensicsja.com
finforensicsja
18
https:// www. finforensicsja.com
com
955
fkrdviscs.com
fkrdviscs.com
fkrdviscs
13
https:// www. fkrdviscs.com
com
956
freestylesinging.com
freestylesinging.com
freestylesinging
20
https:// www. freestylesinging.com
com
957
freeflixac.com
freeflixac.com
freeflixac
14
https:// www. freeflixac.com
com
958
foodiu.com
foodiu.com
foodiu
10
https:// www. foodiu.com
com
959
fancy4fun.com
fancy4fun.com
fancy4fun
13
https:// www. fancy4fun.com
com
960
foxfigitalmovies.com
foxfigitalmovies.com
foxfigitalmovies
20
https:// www. foxfigitalmovies.com
com
961
fillbroadway.com
fillbroadway.com
fillbroadway
16
https:// www. fillbroadway.com
com
962
fanaparis.com
fanaparis.com
fanaparis
13
https:// www. fanaparis.com
com
963
fys9.com
fys9.com
fys9
8
https:// www. fys9.com
com
964
fuzhoupfk.com
fuzhoupfk.com
fuzhoupfk
13
https:// www. fuzhoupfk.com
com
965
fsfwjs.com
fsfwjs.com
fsfwjs
10
https:// www. fsfwjs.com
com
966
filthyrichhairclub.com
filthyrichhairclub.com
filthyrichhairclub
22
https:// www. filthyrichhairclub.com
com
967
findsfunkyresale.com
findsfunkyresale.com
findsfunkyresale
20
https:// www. findsfunkyresale.com
com
968
franescadesimone.com
franescadesimone.com
franescadesimone
20
https:// www. franescadesimone.com
com
969
fluidflushsystems.com
fluidflushsystems.com
fluidflushsystems
21
https:// www. fluidflushsystems.com
com
970
fs-xingchen.com
fs-xingchen.com
fs-xingchen
15
https:// www. fs-xingchen.com
com
971
fashionuni***.com
fashionuni***.com
fashionunisex
17
https:// www. fashionuni***.com
com
972
favlagu.com
favlagu.com
favlagu
11
https:// www. favlagu.com
com
973
fjdjwx.com
fjdjwx.com
fjdjwx
10
https:// www. fjdjwx.com
com
974
familyfarmblitar.com
familyfarmblitar.com
familyfarmblitar
20
https:// www. familyfarmblitar.com
com
975
freescrapmetalcollectionwestmidlands.com
freescrapmetalcollectionwestmidlands.com
freescrapmetalcollectionwestmidlands
40
https:// www. freescrapmetalcollectionwestmidlands.com
com
976
farfromelementary.com
farfromelementary.com
farfromelementary
21
https:// www. farfromelementary.com
com
977
filamcrc.com
filamcrc.com
filamcrc
12
https:// www. filamcrc.com
com
978
fjzbjt.com
fjzbjt.com
fjzbjt
10
https:// www. fjzbjt.com
com
979
freegagent.com
freegagent.com
freegagent
14
https:// www. freegagent.com
com
980
futurefreestyle.com
futurefreestyle.com
futurefreestyle
19
https:// www. futurefreestyle.com
com
981
fenshi520.com
fenshi520.com
fenshi520
13
https:// www. fenshi520.com
com
982
family-bestgifts.com
family-bestgifts.com
family-bestgifts
20
https:// www. family-bestgifts.com
com
983
fyzhan.com
fyzhan.com
fyzhan
10
https:// www. fyzhan.com
com
984
fqdxz.com
fqdxz.com
fqdxz
9
https:// www. fqdxz.com
com
985
floatinggemstone.com
floatinggemstone.com
floatinggemstone
20
https:// www. floatinggemstone.com
com
986
fashioncityshop.com
fashioncityshop.com
fashioncityshop
19
https:// www. fashioncityshop.com
com
987
foamkoozies.com
foamkoozies.com
foamkoozies
15
https:// www. foamkoozies.com
com
988
frecciasport.com
frecciasport.com
frecciasport
16
https:// www. frecciasport.com
com
989
financierayamamoto.com
financierayamamoto.com
financierayamamoto
22
https:// www. financierayamamoto.com
com
990
fkldf.com
fkldf.com
fkldf
9
https:// www. fkldf.com
com
991
fjcxjsw.com
fjcxjsw.com
fjcxjsw
11
https:// www. fjcxjsw.com
com
992
f7420.com
f7420.com
f7420
9
https:// www. f7420.com
com
993
fabriciovillarreal.com
fabriciovillarreal.com
fabriciovillarreal
22
https:// www. fabriciovillarreal.com
com
994
finstroyinvest.com
finstroyinvest.com
finstroyinvest
18
https:// www. finstroyinvest.com
com
995
formerkh.com
formerkh.com
formerkh
12
https:// www. formerkh.com
com
996
faccuweather.com
faccuweather.com
faccuweather
16
https:// www. faccuweather.com
com
997
fashionclothdeals.com
fashionclothdeals.com
fashionclothdeals
21
https:// www. fashionclothdeals.com
com
998
fermgrip.com
fermgrip.com
fermgrip
12
https:// www. fermgrip.com
com
999
fourthopitality.com
fourthopitality.com
fourthopitality
19
https:// www. fourthopitality.com
com
1,000
fb-appauth.com
fb-appauth.com
fb-appauth
14
https:// www. fb-appauth.com
com

Previous page (1) | Current page (2) | Next page (3) | All Pages

Homepage | Privacy Policy

Our sites: Download Apps | Song Lyrics | Submit Articles

Copyright © 2019 Domain Name Registered . All rights reserved.
Cached: IP: 34.226.208.185, 20 February, 2019 11:19:09 (LONDON - UK).

Domain-Name-Registered.Com

All about Domain Name, Domain Tools and Domain Name Database

Free Whois Tool

Check the domain name owner, when it first registration, expire..

Free Domain Checker

Check domain available or not, then can buy or renew or back order

Webpage Header Checker

Free check Webpage Header return thats hidden from users

Daily Domain Name Registration

Free tool to check domain name first registered by day