Domain-Name-Registered.Com

Domain Name Registered on Tuesday Jan 22, 2019 page 2.

There are hundreds of thousands of domains were registered daily, and this place DOMAIN-NAME-REGISTERED.COM is where you can check out almost domains are registered by day. Our domain database is to update list of domains by day, registrar, and extension. Lists contain daily changes (yes, some registrars do register 100k+ domains!). .

Where does this data come from?

All of our data comes from analyzing publicly accessible database from domain registrars. Due to registry restrictions we are only able to download the zones once per day (hence the 48 delay in processing).

#
Domain Name
Main Domain
www
https
Length
Ext
Whois
501
friendsofkirkleyhall.com
friendsofkirkleyhall.com
friendsofkirkleyhall
24
https:// www. friendsofkirkleyhall.com
com
friendsofkirkleyhall.com
502
forgoodmoney.com
forgoodmoney.com
forgoodmoney
16
https:// www. forgoodmoney.com
com
forgoodmoney.com
503
feontgate.com
feontgate.com
feontgate
13
https:// www. feontgate.com
com
feontgate.com
504
favesli.com
favesli.com
favesli
11
https:// www. favesli.com
com
favesli.com
505
forexkon.com
forexkon.com
forexkon
12
https:// www. forexkon.com
com
forexkon.com
506
fillbars.com
fillbars.com
fillbars
12
https:// www. fillbars.com
com
fillbars.com
507
figurewood.com
figurewood.com
figurewood
14
https:// www. figurewood.com
com
figurewood.com
508
fitontheroad.com
fitontheroad.com
fitontheroad
16
https:// www. fitontheroad.com
com
fitontheroad.com
509
funtastespain.com
funtastespain.com
funtastespain
17
https:// www. funtastespain.com
com
funtastespain.com
510
fullcircledivorceassistance.com
fullcircledivorceassistance.com
fullcircledivorceassistance
31
https:// www. fullcircledivorceassistance.com
com
fullcircledivorceassistance.com
511
fletesymudanzaswl.com
fletesymudanzaswl.com
fletesymudanzaswl
21
https:// www. fletesymudanzaswl.com
com
fletesymudanzaswl.com
512
fx160.com
fx160.com
fx160
9
https:// www. fx160.com
com
fx160.com
513
fastrealestatesales.com
fastrealestatesales.com
fastrealestatesales
23
https:// www. fastrealestatesales.com
com
fastrealestatesales.com
514
familyfarmblitar.com
familyfarmblitar.com
familyfarmblitar
20
https:// www. familyfarmblitar.com
com
familyfarmblitar.com
515
faststartcareers.com
faststartcareers.com
faststartcareers
20
https:// www. faststartcareers.com
com
faststartcareers.com
516
fourchee.com
fourchee.com
fourchee
12
https:// www. fourchee.com
com
fourchee.com
517
fc-bb9uhk5hbw.com
fc-bb9uhk5hbw.com
fc-bb9uhk5hbw
17
https:// www. fc-bb9uhk5hbw.com
com
fc-bb9uhk5hbw.com
518
fineartichoke.com
fineartichoke.com
fineartichoke
17
https:// www. fineartichoke.com
com
fineartichoke.com
519
fingsavage.com
fingsavage.com
fingsavage
14
https:// www. fingsavage.com
com
fingsavage.com
520
firstsavingss.com
firstsavingss.com
firstsavingss
17
https:// www. firstsavingss.com
com
firstsavingss.com
521
flashforwardevents.com
flashforwardevents.com
flashforwardevents
22
https:// www. flashforwardevents.com
com
flashforwardevents.com
522
fitomart.com
fitomart.com
fitomart
12
https:// www. fitomart.com
com
fitomart.com
523
fachschaft24.com
fachschaft24.com
fachschaft24
16
https:// www. fachschaft24.com
com
fachschaft24.com
524
fittrainerworld.com
fittrainerworld.com
fittrainerworld
19
https:// www. fittrainerworld.com
com
fittrainerworld.com
525
firsttothekey.com
firsttothekey.com
firsttothekey
17
https:// www. firsttothekey.com
com
firsttothekey.com
526
fundamentaltoys.com
fundamentaltoys.com
fundamentaltoys
19
https:// www. fundamentaltoys.com
com
fundamentaltoys.com
527
favorp.com
favorp.com
favorp
10
https:// www. favorp.com
com
favorp.com
528
futurefreestyle.com
futurefreestyle.com
futurefreestyle
19
https:// www. futurefreestyle.com
com
futurefreestyle.com
529
fyscf.com
fyscf.com
fyscf
9
https:// www. fyscf.com
com
fyscf.com
530
flck3.com
flck3.com
flck3
9
https:// www. flck3.com
com
flck3.com
531
fill***.com
fill***.com
fillsex
11
https:// www. fill***.com
com
fillsex.com
532
faithresults.com
faithresults.com
faithresults
16
https:// www. faithresults.com
com
faithresults.com
533
floridatheseries.com
floridatheseries.com
floridatheseries
20
https:// www. floridatheseries.com
com
floridatheseries.com
534
flugel-photobooks.com
flugel-photobooks.com
flugel-photobooks
21
https:// www. flugel-photobooks.com
com
flugel-photobooks.com
535
fwykw.com
fwykw.com
fwykw
9
https:// www. fwykw.com
com
fwykw.com
536
fourlinesofcode.com
fourlinesofcode.com
fourlinesofcode
19
https:// www. fourlinesofcode.com
com
fourlinesofcode.com
537
fys9.com
fys9.com
fys9
8
https:// www. fys9.com
com
fys9.com
538
fillrealestate.com
fillrealestate.com
fillrealestate
18
https:// www. fillrealestate.com
com
fillrealestate.com
539
fbchillsville.com
fbchillsville.com
fbchillsville
17
https:// www. fbchillsville.com
com
fbchillsville.com
540
faqos.com
faqos.com
faqos
9
https:// www. faqos.com
com
faqos.com
541
forexgto.com
forexgto.com
forexgto
12
https:// www. forexgto.com
com
forexgto.com
542
fkpfhzj.com
fkpfhzj.com
fkpfhzj
11
https:// www. fkpfhzj.com
com
fkpfhzj.com
543
famousvibes.com
famousvibes.com
famousvibes
15
https:// www. famousvibes.com
com
famousvibes.com
544
fortune-g-hk.com
fortune-g-hk.com
fortune-g-hk
16
https:// www. fortune-g-hk.com
com
fortune-g-hk.com
545
frstnews.com
frstnews.com
frstnews
12
https:// www. frstnews.com
com
frstnews.com
546
fragrentjewles.com
fragrentjewles.com
fragrentjewles
18
https:// www. fragrentjewles.com
com
fragrentjewles.com
547
familybotanicalcompany.com
familybotanicalcompany.com
familybotanicalcompany
26
https:// www. familybotanicalcompany.com
com
familybotanicalcompany.com
548
fishinghuntinghshow.com
fishinghuntinghshow.com
fishinghuntinghshow
23
https:// www. fishinghuntinghshow.com
com
fishinghuntinghshow.com
549
francishascheaphomes.com
francishascheaphomes.com
francishascheaphomes
24
https:// www. francishascheaphomes.com
com
francishascheaphomes.com
550
fbcgglenarden.com
fbcgglenarden.com
fbcgglenarden
17
https:// www. fbcgglenarden.com
com
fbcgglenarden.com
551
fd8sam.com
fd8sam.com
fd8sam
10
https:// www. fd8sam.com
com
fd8sam.com
552
franespejo.com
franespejo.com
franespejo
14
https:// www. franespejo.com
com
franespejo.com
553
free-fitting-room.com
free-fitting-room.com
free-fitting-room
21
https:// www. free-fitting-room.com
com
free-fitting-room.com
554
findsfunkyresale.com
findsfunkyresale.com
findsfunkyresale
20
https:// www. findsfunkyresale.com
com
findsfunkyresale.com
555
footselect.com
footselect.com
footselect
14
https:// www. footselect.com
com
footselect.com
556
freegagent.com
freegagent.com
freegagent
14
https:// www. freegagent.com
com
freegagent.com
557
fqcl666.com
fqcl666.com
fqcl666
11
https:// www. fqcl666.com
com
fqcl666.com
558
floatinggemstone.com
floatinggemstone.com
floatinggemstone
20
https:// www. floatinggemstone.com
com
floatinggemstone.com
559
ferienwohnung-mali-losinj.com
ferienwohnung-mali-losinj.com
ferienwohnung-mali-losinj
29
https:// www. ferienwohnung-mali-losinj.com
com
ferienwohnung-mali-losinj.com
560
femdomepire.com
femdomepire.com
femdomepire
15
https:// www. femdomepire.com
com
femdomepire.com
561
f7420.com
f7420.com
f7420
9
https:// www. f7420.com
com
f7420.com
562
forexbotplus.com
forexbotplus.com
forexbotplus
16
https:// www. forexbotplus.com
com
forexbotplus.com
563
fitfirestudios.com
fitfirestudios.com
fitfirestudios
18
https:// www. fitfirestudios.com
com
fitfirestudios.com
564
fillplays.com
fillplays.com
fillplays
13
https:// www. fillplays.com
com
fillplays.com
565
fortsaskatchewaninsurance.com
fortsaskatchewaninsurance.com
fortsaskatchewaninsurance
29
https:// www. fortsaskatchewaninsurance.com
com
fortsaskatchewaninsurance.com
566
funnyrc.com
funnyrc.com
funnyrc
11
https:// www. funnyrc.com
com
funnyrc.com
567
funnelsapp.com
funnelsapp.com
funnelsapp
14
https:// www. funnelsapp.com
com
funnelsapp.com
568
finishyourgreens.com
finishyourgreens.com
finishyourgreens
20
https:// www. finishyourgreens.com
com
finishyourgreens.com
569
fredericskburgrestaurantweek.com
fredericskburgrestaurantweek.com
fredericskburgrestaurantweek
32
https:// www. fredericskburgrestaurantweek.com
com
fredericskburgrestaurantweek.com
570
fireflychaser.com
fireflychaser.com
fireflychaser
17
https:// www. fireflychaser.com
com
fireflychaser.com
571
fiosvw.com
fiosvw.com
fiosvw
10
https:// www. fiosvw.com
com
fiosvw.com
572
fonsee.com
fonsee.com
fonsee
10
https:// www. fonsee.com
com
fonsee.com
573
firstrungcrypto.com
firstrungcrypto.com
firstrungcrypto
19
https:// www. firstrungcrypto.com
com
firstrungcrypto.com
574
fakenewspersonalityroftheyear.com
fakenewspersonalityroftheyear.com
fakenewspersonalityroftheyear
33
https:// www. fakenewspersonalityroftheyear.com
com
fakenewspersonalityroftheyear.com
575
fracters.com
fracters.com
fracters
12
https:// www. fracters.com
com
fracters.com
576
footballsfield.com
footballsfield.com
footballsfield
18
https:// www. footballsfield.com
com
footballsfield.com
577
familydq.com
familydq.com
familydq
12
https:// www. familydq.com
com
familydq.com
578
flosight.com
flosight.com
flosight
12
https:// www. flosight.com
com
flosight.com
579
funlolpics.com
funlolpics.com
funlolpics
14
https:// www. funlolpics.com
com
funlolpics.com
580
fjpj559w3wuz6.com
fjpj559w3wuz6.com
fjpj559w3wuz6
17
https:// www. fjpj559w3wuz6.com
com
fjpj559w3wuz6.com
581
fpinfra.com
fpinfra.com
fpinfra
11
https:// www. fpinfra.com
com
fpinfra.com
582
fitnessmoneyclub.com
fitnessmoneyclub.com
fitnessmoneyclub
20
https:// www. fitnessmoneyclub.com
com
fitnessmoneyclub.com
583
foot-stuff.com
foot-stuff.com
foot-stuff
14
https:// www. foot-stuff.com
com
foot-stuff.com
584
figuredeals.com
figuredeals.com
figuredeals
15
https:// www. figuredeals.com
com
figuredeals.com
585
footbodyguard.com
footbodyguard.com
footbodyguard
17
https:// www. footbodyguard.com
com
footbodyguard.com
586
fitolity.com
fitolity.com
fitolity
12
https:// www. fitolity.com
com
fitolity.com
587
fakepsot.com
fakepsot.com
fakepsot
12
https:// www. fakepsot.com
com
fakepsot.com
588
fortifiedink.com
fortifiedink.com
fortifiedink
16
https:// www. fortifiedink.com
com
fortifiedink.com
589
footballprocoaching.com
footballprocoaching.com
footballprocoaching
23
https:// www. footballprocoaching.com
com
footballprocoaching.com
590
fillbroadway.com
fillbroadway.com
fillbroadway
16
https:// www. fillbroadway.com
com
fillbroadway.com
591
forwardgravel.com
forwardgravel.com
forwardgravel
17
https:// www. forwardgravel.com
com
forwardgravel.com
592
foriegnautoimports.com
foriegnautoimports.com
foriegnautoimports
22
https:// www. foriegnautoimports.com
com
foriegnautoimports.com
593
forexorpro.com
forexorpro.com
forexorpro
14
https:// www. forexorpro.com
com
forexorpro.com
594
fruitvegetablesupplements.com
fruitvegetablesupplements.com
fruitvegetablesupplements
29
https:// www. fruitvegetablesupplements.com
com
fruitvegetablesupplements.com
595
fairhavenband.com
fairhavenband.com
fairhavenband
17
https:// www. fairhavenband.com
com
fairhavenband.com
596
ffjzb.com
ffjzb.com
ffjzb
9
https:// www. ffjzb.com
com
ffjzb.com
597
farfetchs.com
farfetchs.com
farfetchs
13
https:// www. farfetchs.com
com
farfetchs.com
598
forrestersinvestors.com
forrestersinvestors.com
forrestersinvestors
23
https:// www. forrestersinvestors.com
com
forrestersinvestors.com
599
felicegarcia.com
felicegarcia.com
felicegarcia
16
https:// www. felicegarcia.com
com
felicegarcia.com
600
fight-society.com
fight-society.com
fight-society
17
https:// www. fight-society.com
com
fight-society.com
601
fsgholding.com
fsgholding.com
fsgholding
14
https:// www. fsgholding.com
com
fsgholding.com
602
frecciasport.com
frecciasport.com
frecciasport
16
https:// www. frecciasport.com
com
frecciasport.com
603
figsandpoppies.com
figsandpoppies.com
figsandpoppies
18
https:// www. figsandpoppies.com
com
figsandpoppies.com
604
fysinvestments.com
fysinvestments.com
fysinvestments
18
https:// www. fysinvestments.com
com
fysinvestments.com
605
fanatic-okayama.com
fanatic-okayama.com
fanatic-okayama
19
https:// www. fanatic-okayama.com
com
fanatic-okayama.com
606
federalnewsrado.com
federalnewsrado.com
federalnewsrado
19
https:// www. federalnewsrado.com
com
federalnewsrado.com
607
fatecore.com
fatecore.com
fatecore
12
https:// www. fatecore.com
com
fatecore.com
608
fjcxjsw.com
fjcxjsw.com
fjcxjsw
11
https:// www. fjcxjsw.com
com
fjcxjsw.com
609
freenewsz.com
freenewsz.com
freenewsz
13
https:// www. freenewsz.com
com
freenewsz.com
610
foxtau.com
foxtau.com
foxtau
10
https:// www. foxtau.com
com
foxtau.com
611
fjqhjd.com
fjqhjd.com
fjqhjd
10
https:// www. fjqhjd.com
com
fjqhjd.com
612
flc-home.com
flc-home.com
flc-home
12
https:// www. flc-home.com
com
flc-home.com
613
fatimaesanchez.com
fatimaesanchez.com
fatimaesanchez
18
https:// www. fatimaesanchez.com
com
fatimaesanchez.com
614
filamcrc.com
filamcrc.com
filamcrc
12
https:// www. filamcrc.com
com
filamcrc.com
615
flatshareseries.com
flatshareseries.com
flatshareseries
19
https:// www. flatshareseries.com
com
flatshareseries.com
616
freeflixac.com
freeflixac.com
freeflixac
14
https:// www. freeflixac.com
com
freeflixac.com
617
ferramentaskenedy.com
ferramentaskenedy.com
ferramentaskenedy
21
https:// www. ferramentaskenedy.com
com
ferramentaskenedy.com
618
fbcjj.com
fbcjj.com
fbcjj
9
https:// www. fbcjj.com
com
fbcjj.com
619
florrieandboo.com
florrieandboo.com
florrieandboo
17
https:// www. florrieandboo.com
com
florrieandboo.com
620
fontes-sequana.com
fontes-sequana.com
fontes-sequana
18
https:// www. fontes-sequana.com
com
fontes-sequana.com
621
flpbywalter.com
flpbywalter.com
flpbywalter
15
https:// www. flpbywalter.com
com
flpbywalter.com
622
flcashbuy.com
flcashbuy.com
flcashbuy
13
https:// www. flcashbuy.com
com
flcashbuy.com
623
fxfjj.com
fxfjj.com
fxfjj
9
https:// www. fxfjj.com
com
fxfjj.com
624
faccuweather.com
faccuweather.com
faccuweather
16
https:// www. faccuweather.com
com
faccuweather.com
625
flightcloser.com
flightcloser.com
flightcloser
16
https:// www. flightcloser.com
com
flightcloser.com
626
forexprospect.com
forexprospect.com
forexprospect
17
https:// www. forexprospect.com
com
forexprospect.com
627
fabbylists.com
fabbylists.com
fabbylists
14
https:// www. fabbylists.com
com
fabbylists.com
628
findingikigaii.com
findingikigaii.com
findingikigaii
18
https:// www. findingikigaii.com
com
findingikigaii.com
629
fityantra.com
fityantra.com
fityantra
13
https:// www. fityantra.com
com
fityantra.com
630
foresightquality.com
foresightquality.com
foresightquality
20
https:// www. foresightquality.com
com
foresightquality.com
631
feedbackcaller.com
feedbackcaller.com
feedbackcaller
18
https:// www. feedbackcaller.com
com
feedbackcaller.com
632
ferraraforcongress.com
ferraraforcongress.com
ferraraforcongress
22
https:// www. ferraraforcongress.com
com
ferraraforcongress.com
633
fashionuni***.com
fashionuni***.com
fashionunisex
17
https:// www. fashionuni***.com
com
fashionunisex.com
634
flawlessoffers.com
flawlessoffers.com
flawlessoffers
18
https:// www. flawlessoffers.com
com
flawlessoffers.com
635
foodinspirasi.com
foodinspirasi.com
foodinspirasi
17
https:// www. foodinspirasi.com
com
foodinspirasi.com
636
felizsigloxxi.com
felizsigloxxi.com
felizsigloxxi
17
https:// www. felizsigloxxi.com
com
felizsigloxxi.com
637
fibrofitandhealthy.com
fibrofitandhealthy.com
fibrofitandhealthy
22
https:// www. fibrofitandhealthy.com
com
fibrofitandhealthy.com
638
foodvanman.com
foodvanman.com
foodvanman
14
https:// www. foodvanman.com
com
foodvanman.com
639
ferherty.com
ferherty.com
ferherty
12
https:// www. ferherty.com
com
ferherty.com
640
fdacs-cannabis.com
fdacs-cannabis.com
fdacs-cannabis
18
https:// www. fdacs-cannabis.com
com
fdacs-cannabis.com
641
freehostingtrust.com
freehostingtrust.com
freehostingtrust
20
https:// www. freehostingtrust.com
com
freehostingtrust.com
642
florencejosh.com
florencejosh.com
florencejosh
16
https:// www. florencejosh.com
com
florencejosh.com
643
feetassist.com
feetassist.com
feetassist
14
https:// www. feetassist.com
com
feetassist.com
644
fitgelmalaysia.com
fitgelmalaysia.com
fitgelmalaysia
18
https:// www. fitgelmalaysia.com
com
fitgelmalaysia.com
645
foxfinecarpentry.com
foxfinecarpentry.com
foxfinecarpentry
20
https:// www. foxfinecarpentry.com
com
foxfinecarpentry.com
646
freres-et-soeurs.com
freres-et-soeurs.com
freres-et-soeurs
20
https:// www. freres-et-soeurs.com
com
freres-et-soeurs.com
647
freelikers.com
freelikers.com
freelikers
14
https:// www. freelikers.com
com
freelikers.com
648
faithembracesfear.com
faithembracesfear.com
faithembracesfear
21
https:// www. faithembracesfear.com
com
faithembracesfear.com
649
fascnations.com
fascnations.com
fascnations
15
https:// www. fascnations.com
com
fascnations.com
650
formerkh.com
formerkh.com
formerkh
12
https:// www. formerkh.com
com
formerkh.com
651
fkrdviscs.com
fkrdviscs.com
fkrdviscs
13
https:// www. fkrdviscs.com
com
fkrdviscs.com
652
flaskcall.com
flaskcall.com
flaskcall
13
https:// www. flaskcall.com
com
flaskcall.com
653
fringefinance.com
fringefinance.com
fringefinance
17
https:// www. fringefinance.com
com
fringefinance.com
654
freedomcyclist.com
freedomcyclist.com
freedomcyclist
18
https:// www. freedomcyclist.com
com
freedomcyclist.com
655
flormons.com
flormons.com
flormons
12
https:// www. flormons.com
com
flormons.com
656
figuredeal.com
figuredeal.com
figuredeal
14
https:// www. figuredeal.com
com
figuredeal.com
657
filtersvacuum.com
filtersvacuum.com
filtersvacuum
17
https:// www. filtersvacuum.com
com
filtersvacuum.com
658
foreclosureemergency.com
foreclosureemergency.com
foreclosureemergency
24
https:// www. foreclosureemergency.com
com
foreclosureemergency.com
659
funnyx10.com
funnyx10.com
funnyx10
12
https:// www. funnyx10.com
com
funnyx10.com
660
fabkf.com
fabkf.com
fabkf
9
https:// www. fabkf.com
com
fabkf.com
661
foglebags.com
foglebags.com
foglebags
13
https:// www. foglebags.com
com
foglebags.com
662
fitness-w.com
fitness-w.com
fitness-w
13
https:// www. fitness-w.com
com
fitness-w.com
663
flightexpertsales.com
flightexpertsales.com
flightexpertsales
21
https:// www. flightexpertsales.com
com
flightexpertsales.com
664
freshofftheboatvintage.com
freshofftheboatvintage.com
freshofftheboatvintage
26
https:// www. freshofftheboatvintage.com
com
freshofftheboatvintage.com
665
f60wy.com
f60wy.com
f60wy
9
https:// www. f60wy.com
com
f60wy.com
666
fhjgjhdfkjds.com
fhjgjhdfkjds.com
fhjgjhdfkjds
16
https:// www. fhjgjhdfkjds.com
com
fhjgjhdfkjds.com
667
fullmovienew.com
fullmovienew.com
fullmovienew
16
https:// www. fullmovienew.com
com
fullmovienew.com
668
fangrongid.com
fangrongid.com
fangrongid
14
https:// www. fangrongid.com
com
fangrongid.com
669
floretteskincare.com
floretteskincare.com
floretteskincare
20
https:// www. floretteskincare.com
com
floretteskincare.com
670
fillcamp.com
fillcamp.com
fillcamp
12
https:// www. fillcamp.com
com
fillcamp.com
671
fortinetperu.com
fortinetperu.com
fortinetperu
16
https:// www. fortinetperu.com
com
fortinetperu.com
672
floridainternationaltravelexpo.com
floridainternationaltravelexpo.com
floridainternationaltravelexpo
34
https:// www. floridainternationaltravelexpo.com
com
floridainternationaltravelexpo.com
673
freerealestatemoney.com
freerealestatemoney.com
freerealestatemoney
23
https:// www. freerealestatemoney.com
com
freerealestatemoney.com
674
fletesmar.com
fletesmar.com
fletesmar
13
https:// www. fletesmar.com
com
fletesmar.com
675
forbiddencherry.com
forbiddencherry.com
forbiddencherry
19
https:// www. forbiddencherry.com
com
forbiddencherry.com
676
fukenko.com
fukenko.com
fukenko
11
https:// www. fukenko.com
com
fukenko.com
677
family-bestgifts.com
family-bestgifts.com
family-bestgifts
20
https:// www. family-bestgifts.com
com
family-bestgifts.com
678
foeg4ng.com
foeg4ng.com
foeg4ng
11
https:// www. foeg4ng.com
com
foeg4ng.com
679
fillplane.com
fillplane.com
fillplane
13
https:// www. fillplane.com
com
fillplane.com
680
fdcyq8.com
fdcyq8.com
fdcyq8
10
https:// www. fdcyq8.com
com
fdcyq8.com
681
findlovematchmaking.com
findlovematchmaking.com
findlovematchmaking
23
https:// www. findlovematchmaking.com
com
findlovematchmaking.com
682
freesehomeinspections.com
freesehomeinspections.com
freesehomeinspections
25
https:// www. freesehomeinspections.com
com
freesehomeinspections.com
683
firetvsticktricks.com
firetvsticktricks.com
firetvsticktricks
21
https:// www. firetvsticktricks.com
com
firetvsticktricks.com
684
fourcreek.com
fourcreek.com
fourcreek
13
https:// www. fourcreek.com
com
fourcreek.com
685
fllory.com
fllory.com
fllory
10
https:// www. fllory.com
com
fllory.com
686
fluffytots.com
fluffytots.com
fluffytots
14
https:// www. fluffytots.com
com
fluffytots.com
687
fjldd.com
fjldd.com
fjldd
9
https:// www. fjldd.com
com
fjldd.com
688
fireveg.com
fireveg.com
fireveg
11
https:// www. fireveg.com
com
fireveg.com
689
felicialachellesboutique.com
felicialachellesboutique.com
felicialachellesboutique
28
https:// www. felicialachellesboutique.com
com
felicialachellesboutique.com
690
fugiwichita.com
fugiwichita.com
fugiwichita
15
https:// www. fugiwichita.com
com
fugiwichita.com
691
fashionshopks.com
fashionshopks.com
fashionshopks
17
https:// www. fashionshopks.com
com
fashionshopks.com
692
forkonomy.com
forkonomy.com
forkonomy
13
https:// www. forkonomy.com
com
forkonomy.com
693
forwardinghelp.com
forwardinghelp.com
forwardinghelp
18
https:// www. forwardinghelp.com
com
forwardinghelp.com
694
fancy4fun.com
fancy4fun.com
fancy4fun
13
https:// www. fancy4fun.com
com
fancy4fun.com
695
floridahomepb.com
floridahomepb.com
floridahomepb
17
https:// www. floridahomepb.com
com
floridahomepb.com
696
funkclone.com
funkclone.com
funkclone
13
https:// www. funkclone.com
com
funkclone.com
697
flooringcampbell.com
flooringcampbell.com
flooringcampbell
20
https:// www. flooringcampbell.com
com
flooringcampbell.com
698
filthyrichhairclub.com
filthyrichhairclub.com
filthyrichhairclub
22
https:// www. filthyrichhairclub.com
com
filthyrichhairclub.com
699
fraumerle.com
fraumerle.com
fraumerle
13
https:// www. fraumerle.com
com
fraumerle.com
700
flitrosguadalajara.com
flitrosguadalajara.com
flitrosguadalajara
22
https:// www. flitrosguadalajara.com
com
flitrosguadalajara.com
701
fkzj84.com
fkzj84.com
fkzj84
10
https:// www. fkzj84.com
com
fkzj84.com
702
fqbsc.com
fqbsc.com
fqbsc
9
https:// www. fqbsc.com
com
fqbsc.com
703
fetishfashionawards.com
fetishfashionawards.com
fetishfashionawards
23
https:// www. fetishfashionawards.com
com
fetishfashionawards.com
704
fideliascare.com
fideliascare.com
fideliascare
16
https:// www. fideliascare.com
com
fideliascare.com
705
fotocostantini.com
fotocostantini.com
fotocostantini
18
https:// www. fotocostantini.com
com
fotocostantini.com
706
faithesis.com
faithesis.com
faithesis
13
https:// www. faithesis.com
com
faithesis.com
707
firstbilingualprep.com
firstbilingualprep.com
firstbilingualprep
22
https:// www. firstbilingualprep.com
com
firstbilingualprep.com
708
franceappeler.com
franceappeler.com
franceappeler
17
https:// www. franceappeler.com
com
franceappeler.com
709
flotyn.com
flotyn.com
flotyn
10
https:// www. flotyn.com
com
flotyn.com
710
fpkj199.com
fpkj199.com
fpkj199
11
https:// www. fpkj199.com
com
fpkj199.com
711
flippitydippity.com
flippitydippity.com
flippitydippity
19
https:// www. flippitydippity.com
com
flippitydippity.com
712
fishydesigns.com
fishydesigns.com
fishydesigns
16
https:// www. fishydesigns.com
com
fishydesigns.com
713
ffff520.com
ffff520.com
ffff520
11
https:// www. ffff520.com
com
ffff520.com
714
fun-life-info.com
fun-life-info.com
fun-life-info
17
https:// www. fun-life-info.com
com
fun-life-info.com
715
franciscoresendiz.com
franciscoresendiz.com
franciscoresendiz
21
https:// www. franciscoresendiz.com
com
franciscoresendiz.com
716
flamingoautotransport.com
flamingoautotransport.com
flamingoautotransport
25
https:// www. flamingoautotransport.com
com
flamingoautotransport.com
717
foodtruckroute.com
foodtruckroute.com
foodtruckroute
18
https:// www. foodtruckroute.com
com
foodtruckroute.com
718
fyiinvestigator.com
fyiinvestigator.com
fyiinvestigator
19
https:// www. fyiinvestigator.com
com
fyiinvestigator.com
719
fujiadata.com
fujiadata.com
fujiadata
13
https:// www. fujiadata.com
com
fujiadata.com
720
fmoviescab.com
fmoviescab.com
fmoviescab
14
https:// www. fmoviescab.com
com
fmoviescab.com
721
famille-roch.com
famille-roch.com
famille-roch
16
https:// www. famille-roch.com
com
famille-roch.com
722
funsunglass.com
funsunglass.com
funsunglass
15
https:// www. funsunglass.com
com
funsunglass.com
723
freeonlinepennyslotsforfree.com
freeonlinepennyslotsforfree.com
freeonlinepennyslotsforfree
31
https:// www. freeonlinepennyslotsforfree.com
com
freeonlinepennyslotsforfree.com
724
foxsoirts.com
foxsoirts.com
foxsoirts
13
https:// www. foxsoirts.com
com
foxsoirts.com
725
frenchmgmt.com
frenchmgmt.com
frenchmgmt
14
https:// www. frenchmgmt.com
com
frenchmgmt.com
726
fortvuck.com
fortvuck.com
fortvuck
12
https:// www. fortvuck.com
com
fortvuck.com
727
fi2mi.com
fi2mi.com
fi2mi
9
https:// www. fi2mi.com
com
fi2mi.com
728
fkldf.com
fkldf.com
fkldf
9
https:// www. fkldf.com
com
fkldf.com
729
fourloughcheesecake.com
fourloughcheesecake.com
fourloughcheesecake
23
https:// www. fourloughcheesecake.com
com
fourloughcheesecake.com
730
fqsina.com
fqsina.com
fqsina
10
https:// www. fqsina.com
com
fqsina.com
731
freeonlinepaper.com
freeonlinepaper.com
freeonlinepaper
19
https:// www. freeonlinepaper.com
com
freeonlinepaper.com
732
fix-my-tech.com
fix-my-tech.com
fix-my-tech
15
https:// www. fix-my-tech.com
com
fix-my-tech.com
733
fastfitpt.com
fastfitpt.com
fastfitpt
13
https:// www. fastfitpt.com
com
fastfitpt.com
734
fithappyherbivore.com
fithappyherbivore.com
fithappyherbivore
21
https:// www. fithappyherbivore.com
com
fithappyherbivore.com
735
freestylesinging.com
freestylesinging.com
freestylesinging
20
https:// www. freestylesinging.com
com
freestylesinging.com
736
fairytaledates.com
fairytaledates.com
fairytaledates
18
https:// www. fairytaledates.com
com
fairytaledates.com
737
fifa19freebies.com
fifa19freebies.com
fifa19freebies
18
https:// www. fifa19freebies.com
com
fifa19freebies.com
738
fm12315.com
fm12315.com
fm12315
11
https:// www. fm12315.com
com
fm12315.com
739
foltonbank.com
foltonbank.com
foltonbank
14
https:// www. foltonbank.com
com
foltonbank.com
740
fireproofhousing.com
fireproofhousing.com
fireproofhousing
20
https:// www. fireproofhousing.com
com
fireproofhousing.com
741
fernando-store.com
fernando-store.com
fernando-store
18
https:// www. fernando-store.com
com
fernando-store.com
742
fjdak.com
fjdak.com
fjdak
9
https:// www. fjdak.com
com
fjdak.com
743
foamkoozies.com
foamkoozies.com
foamkoozies
15
https:// www. foamkoozies.com
com
foamkoozies.com
744
freegamesunity.com
freegamesunity.com
freegamesunity
18
https:// www. freegamesunity.com
com
freegamesunity.com
745
fngigz.com
fngigz.com
fngigz
10
https:// www. fngigz.com
com
fngigz.com
746
foryourpreciouspet.com
foryourpreciouspet.com
foryourpreciouspet
22
https:// www. foryourpreciouspet.com
com
foryourpreciouspet.com
747
factapi.com
factapi.com
factapi
11
https:// www. factapi.com
com
factapi.com
748
fenshi520.com
fenshi520.com
fenshi520
13
https:// www. fenshi520.com
com
fenshi520.com
749
fithealthybest.com
fithealthybest.com
fithealthybest
18
https:// www. fithealthybest.com
com
fithealthybest.com
750
fruitshades.com
fruitshades.com
fruitshades
15
https:// www. fruitshades.com
com
fruitshades.com
751
flm7788.com
flm7788.com
flm7788
11
https:// www. flm7788.com
com
flm7788.com
752
feihuanyule.com
feihuanyule.com
feihuanyule
15
https:// www. feihuanyule.com
com
feihuanyule.com
753
fermgrip.com
fermgrip.com
fermgrip
12
https:// www. fermgrip.com
com
fermgrip.com
754
funbookmarking.com
funbookmarking.com
funbookmarking
18
https:// www. funbookmarking.com
com
funbookmarking.com
755
fluahingbank.com
fluahingbank.com
fluahingbank
16
https:// www. fluahingbank.com
com
fluahingbank.com
756
foreverhjs.com
foreverhjs.com
foreverhjs
14
https:// www. foreverhjs.com
com
foreverhjs.com
757
fitexpertone.com
fitexpertone.com
fitexpertone
16
https:// www. fitexpertone.com
com
fitexpertone.com
758
full-cc.com
full-cc.com
full-cc
11
https:// www. full-cc.com
com
full-cc.com
759
fuzhouxisu.com
fuzhouxisu.com
fuzhouxisu
14
https:// www. fuzhouxisu.com
com
fuzhouxisu.com
760
fourdublin.com
fourdublin.com
fourdublin
14
https:// www. fourdublin.com
com
fourdublin.com
761
fabjt.com
fabjt.com
fabjt
9
https:// www. fabjt.com
com
fabjt.com
762
funnyyoushouldasktv.com
funnyyoushouldasktv.com
funnyyoushouldasktv
23
https:// www. funnyyoushouldasktv.com
com
funnyyoushouldasktv.com
763
ffqq6789.com
ffqq6789.com
ffqq6789
12
https:// www. ffqq6789.com
com
ffqq6789.com
764
fa079.com
fa079.com
fa079
9
https:// www. fa079.com
com
fa079.com
765
famoussteaksushi.com
famoussteaksushi.com
famoussteaksushi
20
https:// www. famoussteaksushi.com
com
famoussteaksushi.com
766
fizzedrocks.com
fizzedrocks.com
fizzedrocks
15
https:// www. fizzedrocks.com
com
fizzedrocks.com
767
fienon.com
fienon.com
fienon
10
https:// www. fienon.com
com
fienon.com
768
funakura-seikotsu.com
funakura-seikotsu.com
funakura-seikotsu
21
https:// www. funakura-seikotsu.com
com
funakura-seikotsu.com
769
fitdoula.com
fitdoula.com
fitdoula
12
https:// www. fitdoula.com
com
fitdoula.com
770
fjqiaodong.com
fjqiaodong.com
fjqiaodong
14
https:// www. fjqiaodong.com
com
fjqiaodong.com
771
fit-ergysport.com
fit-ergysport.com
fit-ergysport
17
https:// www. fit-ergysport.com
com
fit-ergysport.com
772
fleksitariskmat.com
fleksitariskmat.com
fleksitariskmat
19
https:// www. fleksitariskmat.com
com
fleksitariskmat.com
773
foxfigitalmovies.com
foxfigitalmovies.com
foxfigitalmovies
20
https:// www. foxfigitalmovies.com
com
foxfigitalmovies.com
774
favlagu.com
favlagu.com
favlagu
11
https:// www. favlagu.com
com
favlagu.com
775
fredbergerdesignandbuild.com
fredbergerdesignandbuild.com
fredbergerdesignandbuild
28
https:// www. fredbergerdesignandbuild.com
com
fredbergerdesignandbuild.com
776
fensemao.com
fensemao.com
fensemao
12
https:// www. fensemao.com
com
fensemao.com
777
finforensicsja.com
finforensicsja.com
finforensicsja
18
https:// www. finforensicsja.com
com
finforensicsja.com
778
fanrad.com
fanrad.com
fanrad
10
https:// www. fanrad.com
com
fanrad.com
779
finishlinestrategies.com
finishlinestrategies.com
finishlinestrategies
24
https:// www. finishlinestrategies.com
com
finishlinestrategies.com
780
flyyuyan.com
flyyuyan.com
flyyuyan
12
https:// www. flyyuyan.com
com
flyyuyan.com
781
fjzbjt.com
fjzbjt.com
fjzbjt
10
https:// www. fjzbjt.com
com
fjzbjt.com
782
firfold.com
firfold.com
firfold
11
https:// www. firfold.com
com
firfold.com
783
fuzhouxww123.com
fuzhouxww123.com
fuzhouxww123
16
https:// www. fuzhouxww123.com
com
fuzhouxww123.com
784
fieldstein.com
fieldstein.com
fieldstein
14
https:// www. fieldstein.com
com
fieldstein.com
785
formothersatkaust.com
formothersatkaust.com
formothersatkaust
21
https:// www. formothersatkaust.com
com
formothersatkaust.com
786
frequencyofprovision.com
frequencyofprovision.com
frequencyofprovision
24
https:// www. frequencyofprovision.com
com
frequencyofprovision.com
787
fastestponies.com
fastestponies.com
fastestponies
17
https:// www. fastestponies.com
com
fastestponies.com
788
facthus.com
facthus.com
facthus
11
https:// www. facthus.com
com
facthus.com
789
flugplanung.com
flugplanung.com
flugplanung
15
https:// www. flugplanung.com
com
flugplanung.com
790
fashionclothdeals.com
fashionclothdeals.com
fashionclothdeals
21
https:// www. fashionclothdeals.com
com
fashionclothdeals.com
791
flordiaapartmentphotos.com
flordiaapartmentphotos.com
flordiaapartmentphotos
26
https:// www. flordiaapartmentphotos.com
com
flordiaapartmentphotos.com
792
fosteredlove.com
fosteredlove.com
fosteredlove
16
https:// www. fosteredlove.com
com
fosteredlove.com
793
fabricdirectblog.com
fabricdirectblog.com
fabricdirectblog
20
https:// www. fabricdirectblog.com
com
fabricdirectblog.com
794
fongleng.com
fongleng.com
fongleng
12
https:// www. fongleng.com
com
fongleng.com
795
fairishgroove.com
fairishgroove.com
fairishgroove
17
https:// www. fairishgroove.com
com
fairishgroove.com
796
fastestpony.com
fastestpony.com
fastestpony
15
https:// www. fastestpony.com
com
fastestpony.com
797
fillproperty.com
fillproperty.com
fillproperty
16
https:// www. fillproperty.com
com
fillproperty.com
798
farmerknee.com
farmerknee.com
farmerknee
14
https:// www. farmerknee.com
com
farmerknee.com
799
felloffdatruck.com
felloffdatruck.com
felloffdatruck
18
https:// www. felloffdatruck.com
com
felloffdatruck.com
800
fxorange.com
fxorange.com
fxorange
12
https:// www. fxorange.com
com
fxorange.com
801
flete-seguro.com
flete-seguro.com
flete-seguro
16
https:// www. flete-seguro.com
com
flete-seguro.com
802
fastfirerecords.com
fastfirerecords.com
fastfirerecords
19
https:// www. fastfirerecords.com
com
fastfirerecords.com
803
florxpress.com
florxpress.com
florxpress
14
https:// www. florxpress.com
com
florxpress.com
804
f74ypb.com
f74ypb.com
f74ypb
10
https:// www. f74ypb.com
com
f74ypb.com
805
freshofout***s.com
freshofout***s.com
freshofoutfucks
19
https:// www. freshofout***s.com
com
freshofoutfucks.com
806
fllowze.com
fllowze.com
fllowze
11
https:// www. fllowze.com
com
fllowze.com
807
fun-teng.com
fun-teng.com
fun-teng
12
https:// www. fun-teng.com
com
fun-teng.com
808
felixbacik.com
felixbacik.com
felixbacik
14
https:// www. felixbacik.com
com
felixbacik.com
809
falconpreview.com
falconpreview.com
falconpreview
17
https:// www. falconpreview.com
com
falconpreview.com
810
fitnessbootcampaustin.com
fitnessbootcampaustin.com
fitnessbootcampaustin
25
https:// www. fitnessbootcampaustin.com
com
fitnessbootcampaustin.com
811
fewoluedenscheid.com
fewoluedenscheid.com
fewoluedenscheid
20
https:// www. fewoluedenscheid.com
com
fewoluedenscheid.com
812
fwengyl.com
fwengyl.com
fwengyl
11
https:// www. fwengyl.com
com
fwengyl.com
813
fireuplife.com
fireuplife.com
fireuplife
14
https:// www. fireuplife.com
com
fireuplife.com
814
freeibookstemplates.com
freeibookstemplates.com
freeibookstemplates
23
https:// www. freeibookstemplates.com
com
freeibookstemplates.com
815
files-castle.com
files-castle.com
files-castle
16
https:// www. files-castle.com
com
files-castle.com
816
fozziesfuzzies.com
fozziesfuzzies.com
fozziesfuzzies
18
https:// www. fozziesfuzzies.com
com
fozziesfuzzies.com
817
flikzer.com
flikzer.com
flikzer
11
https:// www. flikzer.com
com
flikzer.com
818
frontierspinining.com
frontierspinining.com
frontierspinining
21
https:// www. frontierspinining.com
com
frontierspinining.com
819
finghers.com
finghers.com
finghers
12
https:// www. finghers.com
com
finghers.com
820
foodindustryena.com
foodindustryena.com
foodindustryena
19
https:// www. foodindustryena.com
com
foodindustryena.com
821
fluidflushsystems.com
fluidflushsystems.com
fluidflushsystems
21
https:// www. fluidflushsystems.com
com
fluidflushsystems.com
822
filmautotech.com
filmautotech.com
filmautotech
16
https:// www. filmautotech.com
com
filmautotech.com
823
freemax360.com
freemax360.com
freemax360
14
https:// www. freemax360.com
com
freemax360.com
824
fourling.com
fourling.com
fourling
12
https:// www. fourling.com
com
fourling.com
825
farizchowdhury.com
farizchowdhury.com
farizchowdhury
18
https:// www. farizchowdhury.com
com
farizchowdhury.com
826
floorcleaningjacksonville.com
floorcleaningjacksonville.com
floorcleaningjacksonville
29
https:// www. floorcleaningjacksonville.com
com
floorcleaningjacksonville.com
827
fjdjwx.com
fjdjwx.com
fjdjwx
10
https:// www. fjdjwx.com
com
fjdjwx.com
828
floridalandassociates.com
floridalandassociates.com
floridalandassociates
25
https:// www. floridalandassociates.com
com
floridalandassociates.com
829
finachic.com
finachic.com
finachic
12
https:// www. finachic.com
com
finachic.com
830
freesupershot.com
freesupershot.com
freesupershot
17
https:// www. freesupershot.com
com
freesupershot.com
831
fscbm.com
fscbm.com
fscbm
9
https:// www. fscbm.com
com
fscbm.com
832
freecreditscore2go.com
freecreditscore2go.com
freecreditscore2go
22
https:// www. freecreditscore2go.com
com
freecreditscore2go.com
833
fabswomgers.com
fabswomgers.com
fabswomgers
15
https:// www. fabswomgers.com
com
fabswomgers.com
834
fzgljd.com
fzgljd.com
fzgljd
10
https:// www. fzgljd.com
com
fzgljd.com
835
fahrtalent.com
fahrtalent.com
fahrtalent
14
https:// www. fahrtalent.com
com
fahrtalent.com
836
fundsaccntsolutions.com
fundsaccntsolutions.com
fundsaccntsolutions
23
https:// www. fundsaccntsolutions.com
com
fundsaccntsolutions.com
837
face2table.com
face2table.com
face2table
14
https:// www. face2table.com
com
face2table.com
838
fabnotfat.com
fabnotfat.com
fabnotfat
13
https:// www. fabnotfat.com
com
fabnotfat.com
839
financialtwins.com
financialtwins.com
financialtwins
18
https:// www. financialtwins.com
com
financialtwins.com
840
feritnuhoglu.com
feritnuhoglu.com
feritnuhoglu
16
https:// www. feritnuhoglu.com
com
feritnuhoglu.com
841
fgxbgr.com
fgxbgr.com
fgxbgr
10
https:// www. fgxbgr.com
com
fgxbgr.com
842
fortierboatsinc.com
fortierboatsinc.com
fortierboatsinc
19
https:// www. fortierboatsinc.com
com
fortierboatsinc.com
843
forodelseo.com
forodelseo.com
forodelseo
14
https:// www. forodelseo.com
com
forodelseo.com
844
firstbaptistsouthhill.com
firstbaptistsouthhill.com
firstbaptistsouthhill
25
https:// www. firstbaptistsouthhill.com
com
firstbaptistsouthhill.com
845
floridahomemortgageloans.com
floridahomemortgageloans.com
floridahomemortgageloans
28
https:// www. floridahomemortgageloans.com
com
floridahomemortgageloans.com
846
fanaparis.com
fanaparis.com
fanaparis
13
https:// www. fanaparis.com
com
fanaparis.com
847
foodiu.com
foodiu.com
foodiu
10
https:// www. foodiu.com
com
foodiu.com
848
fullbul.com
fullbul.com
fullbul
11
https:// www. fullbul.com
com
fullbul.com
849
fancyloves.com
fancyloves.com
fancyloves
14
https:// www. fancyloves.com
com
fancyloves.com
850
fliincus.com
fliincus.com
fliincus
12
https:// www. fliincus.com
com
fliincus.com
851
faravarf.com
faravarf.com
faravarf
12
https:// www. faravarf.com
com
faravarf.com
852
feedachildevents.com
feedachildevents.com
feedachildevents
20
https:// www. feedachildevents.com
com
feedachildevents.com
853
fivetrader.com
fivetrader.com
fivetrader
14
https:// www. fivetrader.com
com
fivetrader.com
854
freeanswerguide.com
freeanswerguide.com
freeanswerguide
19
https:// www. freeanswerguide.com
com
freeanswerguide.com
855
floydbrownmusic.com
floydbrownmusic.com
floydbrownmusic
19
https:// www. floydbrownmusic.com
com
floydbrownmusic.com
856
fbdjj.com
fbdjj.com
fbdjj
9
https:// www. fbdjj.com
com
fbdjj.com
857
fruitshade.com
fruitshade.com
fruitshade
14
https:// www. fruitshade.com
com
fruitshade.com
858
flsmd.com
flsmd.com
flsmd
9
https:// www. flsmd.com
com
flsmd.com
859
fluffyrufflesboutique.com
fluffyrufflesboutique.com
fluffyrufflesboutique
25
https:// www. fluffyrufflesboutique.com
com
fluffyrufflesboutique.com
860
friendlyfin.com
friendlyfin.com
friendlyfin
15
https:// www. friendlyfin.com
com
friendlyfin.com
861
freelancefemmes.com
freelancefemmes.com
freelancefemmes
19
https:// www. freelancefemmes.com
com
freelancefemmes.com
862
fallenlemmings.com
fallenlemmings.com
fallenlemmings
18
https:// www. fallenlemmings.com
com
fallenlemmings.com
863
fltonbank.com
fltonbank.com
fltonbank
13
https:// www. fltonbank.com
com
fltonbank.com
864
findinghalcyon.com
findinghalcyon.com
findinghalcyon
18
https:// www. findinghalcyon.com
com
findinghalcyon.com
865
franescadesimone.com
franescadesimone.com
franescadesimone
20
https:// www. franescadesimone.com
com
franescadesimone.com
866
fomaska.com
fomaska.com
fomaska
11
https:// www. fomaska.com
com
fomaska.com
867
fourthopitality.com
fourthopitality.com
fourthopitality
19
https:// www. fourthopitality.com
com
fourthopitality.com
868
flightcentrebuyback.com
flightcentrebuyback.com
flightcentrebuyback
23
https:// www. flightcentrebuyback.com
com
flightcentrebuyback.com
869
frischfrostservice.com
frischfrostservice.com
frischfrostservice
22
https:// www. frischfrostservice.com
com
frischfrostservice.com
870
forbiddensnack.com
forbiddensnack.com
forbiddensnack
18
https:// www. forbiddensnack.com
com
forbiddensnack.com
871
financierayamamoto.com
financierayamamoto.com
financierayamamoto
22
https:// www. financierayamamoto.com
com
financierayamamoto.com
872
fernandonatalici.com
fernandonatalici.com
fernandonatalici
20
https:// www. fernandonatalici.com
com
fernandonatalici.com
873
facemcgee.com
facemcgee.com
facemcgee
13
https:// www. facemcgee.com
com
facemcgee.com
874
filtervacuum.com
filtervacuum.com
filtervacuum
16
https:// www. filtervacuum.com
com
filtervacuum.com
875
following-garyvee.com
following-garyvee.com
following-garyvee
21
https:// www. following-garyvee.com
com
following-garyvee.com
876
fourmatix.com
fourmatix.com
fourmatix
13
https:// www. fourmatix.com
com
fourmatix.com
877
fraifrais.com
fraifrais.com
fraifrais
13
https:// www. fraifrais.com
com
fraifrais.com
878
forgemontana.com
forgemontana.com
forgemontana
16
https:// www. forgemontana.com
com
forgemontana.com
879
fannysfurniturekelowna.com
fannysfurniturekelowna.com
fannysfurniturekelowna
26
https:// www. fannysfurniturekelowna.com
com
fannysfurniturekelowna.com
880
fdacs-hemp.com
fdacs-hemp.com
fdacs-hemp
14
https:// www. fdacs-hemp.com
com
fdacs-hemp.com
881
fsfwjs.com
fsfwjs.com
fsfwjs
10
https:// www. fsfwjs.com
com
fsfwjs.com
882
flushingfoo.com
flushingfoo.com
flushingfoo
15
https:// www. flushingfoo.com
com
flushingfoo.com
883
floridainvestorsrealty.com
floridainvestorsrealty.com
floridainvestorsrealty
26
https:// www. floridainvestorsrealty.com
com
floridainvestorsrealty.com
884
fz-222.com
fz-222.com
fz-222
10
https:// www. fz-222.com
com
fz-222.com
885
ferreyrolaundryservice.com
ferreyrolaundryservice.com
ferreyrolaundryservice
26
https:// www. ferreyrolaundryservice.com
com
ferreyrolaundryservice.com
886
fashionflatlayz.com
fashionflatlayz.com
fashionflatlayz
19
https:// www. fashionflatlayz.com
com
fashionflatlayz.com
887
fitvulva.com
fitvulva.com
fitvulva
12
https:// www. fitvulva.com
com
fitvulva.com
888
fellnew.com
fellnew.com
fellnew
11
https:// www. fellnew.com
com
fellnew.com
889
fortunefindersinc.com
fortunefindersinc.com
fortunefindersinc
21
https:// www. fortunefindersinc.com
com
fortunefindersinc.com
890
fz-111.com
fz-111.com
fz-111
10
https:// www. fz-111.com
com
fz-111.com
891
finstroyinvest.com
finstroyinvest.com
finstroyinvest
18
https:// www. finstroyinvest.com
com
finstroyinvest.com
892
farmsforum.com
farmsforum.com
farmsforum
14
https:// www. farmsforum.com
com
farmsforum.com
893
fordfanhalloffame.com
fordfanhalloffame.com
fordfanhalloffame
21
https:// www. fordfanhalloffame.com
com
fordfanhalloffame.com
894
fitrat.com
fitrat.com
fitrat
10
https:// www. fitrat.com
com
fitrat.com
895
fastcashoffernc.com
fastcashoffernc.com
fastcashoffernc
19
https:// www. fastcashoffernc.com
com
fastcashoffernc.com
896
fuzhoupfk.com
fuzhoupfk.com
fuzhoupfk
13
https:// www. fuzhoupfk.com
com
fuzhoupfk.com
897
fsshuo.com
fsshuo.com
fsshuo
10
https:// www. fsshuo.com
com
fsshuo.com
898
fireupusa.com
fireupusa.com
fireupusa
13
https:// www. fireupusa.com
com
fireupusa.com
899
fingerscadburysfc.com
fingerscadburysfc.com
fingerscadburysfc
21
https:// www. fingerscadburysfc.com
com
fingerscadburysfc.com
900
foodisnotafight.com
foodisnotafight.com
foodisnotafight
19
https:// www. foodisnotafight.com
com
foodisnotafight.com
901
fxtplatform.com
fxtplatform.com
fxtplatform
15
https:// www. fxtplatform.com
com
fxtplatform.com
902
flurofun.com
flurofun.com
flurofun
12
https:// www. flurofun.com
com
flurofun.com
903
farmshaker.com
farmshaker.com
farmshaker
14
https:// www. farmshaker.com
com
farmshaker.com
904
frenzyandco.com
frenzyandco.com
frenzyandco
15
https:// www. frenzyandco.com
com
frenzyandco.com
905
fwyjj.com
fwyjj.com
fwyjj
9
https:// www. fwyjj.com
com
fwyjj.com
906
fanryes.com
fanryes.com
fanryes
11
https:// www. fanryes.com
com
fanryes.com
907
fireweedfloral.com
fireweedfloral.com
fireweedfloral
18
https:// www. fireweedfloral.com
com
fireweedfloral.com
908
fakrfak.com
fakrfak.com
fakrfak
11
https:// www. fakrfak.com
com
fakrfak.com
909
farfromelementary.com
farfromelementary.com
farfromelementary
21
https:// www. farfromelementary.com
com
farfromelementary.com
910
fsmaweebly.com
fsmaweebly.com
fsmaweebly
14
https:// www. fsmaweebly.com
com
fsmaweebly.com
911
fadcosplay.com
fadcosplay.com
fadcosplay
14
https:// www. fadcosplay.com
com
fadcosplay.com
912
fernandomorenojr.com
fernandomorenojr.com
fernandomorenojr
20
https:// www. fernandomorenojr.com
com
fernandomorenojr.com
913
fabriciovillarreal.com
fabriciovillarreal.com
fabriciovillarreal
22
https:// www. fabriciovillarreal.com
com
fabriciovillarreal.com
914
floatingfolks.com
floatingfolks.com
floatingfolks
17
https:// www. floatingfolks.com
com
floatingfolks.com
915
factassist.com
factassist.com
factassist
14
https:// www. factassist.com
com
factassist.com
916
fubicai.com
fubicai.com
fubicai
11
https:// www. fubicai.com
com
fubicai.com
917
fivetofeelalive.com
fivetofeelalive.com
fivetofeelalive
19
https:// www. fivetofeelalive.com
com
fivetofeelalive.com
918
ffglobetrotter.com
ffglobetrotter.com
ffglobetrotter
18
https:// www. ffglobetrotter.com
com
ffglobetrotter.com
919
funnysauce.com
funnysauce.com
funnysauce
14
https:// www. funnysauce.com
com
funnysauce.com
920
fordelegate.com
fordelegate.com
fordelegate
15
https:// www. fordelegate.com
com
fordelegate.com
921
floodprotectionmadesimple.com
floodprotectionmadesimple.com
floodprotectionmadesimple
29
https:// www. floodprotectionmadesimple.com
com
floodprotectionmadesimple.com
922
floridajen.com
floridajen.com
floridajen
14
https:// www. floridajen.com
com
floridajen.com
923
feitong2008.com
feitong2008.com
feitong2008
15
https:// www. feitong2008.com
com
feitong2008.com
924
flordiageorgialine.com
flordiageorgialine.com
flordiageorgialine
22
https:// www. flordiageorgialine.com
com
flordiageorgialine.com
925
floridabayadventuresinc.com
floridabayadventuresinc.com
floridabayadventuresinc
27
https:// www. floridabayadventuresinc.com
com
floridabayadventuresinc.com
926
flowergirlsandmore.com
flowergirlsandmore.com
flowergirlsandmore
22
https:// www. flowergirlsandmore.com
com
flowergirlsandmore.com
927
freyjaha.com
freyjaha.com
freyjaha
12
https:// www. freyjaha.com
com
freyjaha.com
928
fujairahrun.com
fujairahrun.com
fujairahrun
15
https:// www. fujairahrun.com
com
fujairahrun.com
929
fortnightworlds.com
fortnightworlds.com
fortnightworlds
19
https:// www. fortnightworlds.com
com
fortnightworlds.com
930
futureeyeeartificialintelligence.com
futureeyeeartificialintelligence.com
futureeyeeartificialintelligence
36
https:// www. futureeyeeartificialintelligence.com
com
futureeyeeartificialintelligence.com
931
femdecs.com
femdecs.com
femdecs
11
https:// www. femdecs.com
com
femdecs.com
932
freescrapmetalcollectionwestmidlands.com
freescrapmetalcollectionwestmidlands.com
freescrapmetalcollectionwestmidlands
40
https:// www. freescrapmetalcollectionwestmidlands.com
com
freescrapmetalcollectionwestmidlands.com
933
frenchbulldog-sanfrancisco.com
frenchbulldog-sanfrancisco.com
frenchbulldog-sanfrancisco
30
https:// www. frenchbulldog-sanfrancisco.com
com
frenchbulldog-sanfrancisco.com
934
fitbydrsmith.com
fitbydrsmith.com
fitbydrsmith
16
https:// www. fitbydrsmith.com
com
fitbydrsmith.com
935
falconsneakpeek.com
falconsneakpeek.com
falconsneakpeek
19
https:// www. falconsneakpeek.com
com
falconsneakpeek.com
936
futureindiapay.com
futureindiapay.com
futureindiapay
18
https:// www. futureindiapay.com
com
futureindiapay.com
937
fortressraid.com
fortressraid.com
fortressraid
16
https:// www. fortressraid.com
com
fortressraid.com
938
fayxsm.com
fayxsm.com
fayxsm
10
https:// www. fayxsm.com
com
fayxsm.com
939
freetimevalue.com
freetimevalue.com
freetimevalue
17
https:// www. freetimevalue.com
com
freetimevalue.com
940
fifty6marketing.com
fifty6marketing.com
fifty6marketing
19
https:// www. fifty6marketing.com
com
fifty6marketing.com
941
fianceexpress.com
fianceexpress.com
fianceexpress
17
https:// www. fianceexpress.com
com
fianceexpress.com
942
fujiahealth.com
fujiahealth.com
fujiahealth
15
https:// www. fujiahealth.com
com
fujiahealth.com
943
fujikin-usa.com
fujikin-usa.com
fujikin-usa
15
https:// www. fujikin-usa.com
com
fujikin-usa.com
944
farhack.com
farhack.com
farhack
11
https:// www. farhack.com
com
farhack.com
945
fqdxz.com
fqdxz.com
fqdxz
9
https:// www. fqdxz.com
com
fqdxz.com
946
fabulashz.com
fabulashz.com
fabulashz
13
https:// www. fabulashz.com
com
fabulashz.com
947
foxfarmnursery.com
foxfarmnursery.com
foxfarmnursery
18
https:// www. foxfarmnursery.com
com
foxfarmnursery.com
948
flippped.com
flippped.com
flippped
12
https:// www. flippped.com
com
flippped.com
949
fjjsjyw.com
fjjsjyw.com
fjjsjyw
11
https:// www. fjjsjyw.com
com
fjjsjyw.com
950
fb-appauth.com
fb-appauth.com
fb-appauth
14
https:// www. fb-appauth.com
com
fb-appauth.com
951
fdjhghjhdf.com
fdjhghjhdf.com
fdjhghjhdf
14
https:// www. fdjhghjhdf.com
com
fdjhghjhdf.com
952
foreigndomesticworkersassociationofamerica.com
foreigndomesticworkersassociationofamerica.com
foreigndomesticworkersassociationofamerica
46
https:// www. foreigndomesticworkersassociationofamerica.com
com
foreigndomesticworkersassociationofamerica.com
953
firstsbankcard.com
firstsbankcard.com
firstsbankcard
18
https:// www. firstsbankcard.com
com
firstsbankcard.com
954
fugeit.com
fugeit.com
fugeit
10
https:// www. fugeit.com
com
fugeit.com
955
flushingdating.com
flushingdating.com
flushingdating
18
https:// www. flushingdating.com
com
flushingdating.com
956
fabfw.com
fabfw.com
fabfw
9
https:// www. fabfw.com
com
fabfw.com
957
fastholerunning.com
fastholerunning.com
fastholerunning
19
https:// www. fastholerunning.com
com
fastholerunning.com
958
f7a5lv.com
f7a5lv.com
f7a5lv
10
https:// www. f7a5lv.com
com
f7a5lv.com
959
feigseoa.com
feigseoa.com
feigseoa
12
https:// www. feigseoa.com
com
feigseoa.com
960
farnivest.com
farnivest.com
farnivest
13
https:// www. farnivest.com
com
farnivest.com
961
fs-xingchen.com
fs-xingchen.com
fs-xingchen
15
https:// www. fs-xingchen.com
com
fs-xingchen.com
962
finisity.com
finisity.com
finisity
12
https:// www. finisity.com
com
finisity.com
963
firezz.com
firezz.com
firezz
10
https:// www. firezz.com
com
firezz.com
964
fitnesszonedesk.com
fitnesszonedesk.com
fitnesszonedesk
19
https:// www. fitnesszonedesk.com
com
fitnesszonedesk.com
965
fatehjangmart.com
fatehjangmart.com
fatehjangmart
17
https:// www. fatehjangmart.com
com
fatehjangmart.com
966
fishinggreatlakes.com
fishinggreatlakes.com
fishinggreatlakes
21
https:// www. fishinggreatlakes.com
com
fishinggreatlakes.com
967
fbcreator.com
fbcreator.com
fbcreator
13
https:// www. fbcreator.com
com
fbcreator.com
968
fsfous.com
fsfous.com
fsfous
10
https:// www. fsfous.com
com
fsfous.com
969
fortunegourmetchinese.com
fortunegourmetchinese.com
fortunegourmetchinese
25
https:// www. fortunegourmetchinese.com
com
fortunegourmetchinese.com
970
firesidefamily.com
firesidefamily.com
firesidefamily
18
https:// www. firesidefamily.com
com
firesidefamily.com
971
fadacailiuliu7.com
fadacailiuliu7.com
fadacailiuliu7
18
https:// www. fadacailiuliu7.com
com
fadacailiuliu7.com
972
fourmea.com
fourmea.com
fourmea
11
https:// www. fourmea.com
com
fourmea.com
973
foyerrealty.com
foyerrealty.com
foyerrealty
15
https:// www. foyerrealty.com
com
foyerrealty.com
974
forevergasque.com
forevergasque.com
forevergasque
17
https:// www. forevergasque.com
com
forevergasque.com
975
fittoflush.com
fittoflush.com
fittoflush
14
https:// www. fittoflush.com
com
fittoflush.com
976
fredeticksburg.com
fredeticksburg.com
fredeticksburg
18
https:// www. fredeticksburg.com
com
fredeticksburg.com
977
fo3ir.com
fo3ir.com
fo3ir
9
https:// www. fo3ir.com
com
fo3ir.com
978
fpsmy.com
fpsmy.com
fpsmy
9
https:// www. fpsmy.com
com
fpsmy.com
979
floyd-education.com
floyd-education.com
floyd-education
19
https:// www. floyd-education.com
com
floyd-education.com
980
freesunglassesonline.com
freesunglassesonline.com
freesunglassesonline
24
https:// www. freesunglassesonline.com
com
freesunglassesonline.com
981
fitfedclub.com
fitfedclub.com
fitfedclub
14
https:// www. fitfedclub.com
com
fitfedclub.com
982
firstbead.com
firstbead.com
firstbead
13
https:// www. firstbead.com
com
firstbead.com
983
freefurnancenj.com
freefurnancenj.com
freefurnancenj
18
https:// www. freefurnancenj.com
com
freefurnancenj.com
984
fromthebloc.com
fromthebloc.com
fromthebloc
15
https:// www. fromthebloc.com
com
fromthebloc.com
985
fyzhan.com
fyzhan.com
fyzhan
10
https:// www. fyzhan.com
com
fyzhan.com
986
f3000d.com
f3000d.com
f3000d
10
https:// www. f3000d.com
com
f3000d.com
987
funachina.com
funachina.com
funachina
13
https:// www. funachina.com
com
funachina.com
988
frenchriviera-bijoux.com
frenchriviera-bijoux.com
frenchriviera-bijoux
24
https:// www. frenchriviera-bijoux.com
com
frenchriviera-bijoux.com
989
fthsd.com
fthsd.com
fthsd
9
https:// www. fthsd.com
com
fthsd.com
990
fairfaxcosmeticsurgery.com
fairfaxcosmeticsurgery.com
fairfaxcosmeticsurgery
26
https:// www. fairfaxcosmeticsurgery.com
com
fairfaxcosmeticsurgery.com
991
firsttouchsd.com
firsttouchsd.com
firsttouchsd
16
https:// www. firsttouchsd.com
com
firsttouchsd.com
992
fogeloch.com
fogeloch.com
fogeloch
12
https:// www. fogeloch.com
com
fogeloch.com
993
fujakurniawan.com
fujakurniawan.com
fujakurniawan
17
https:// www. fujakurniawan.com
com
fujakurniawan.com
994
fashioncityshop.com
fashioncityshop.com
fashioncityshop
19
https:// www. fashioncityshop.com
com
fashioncityshop.com
995
fbbjy.com
fbbjy.com
fbbjy
9
https:// www. fbbjy.com
com
fbbjy.com
996
faithfullyjoyful.com
faithfullyjoyful.com
faithfullyjoyful
20
https:// www. faithfullyjoyful.com
com
faithfullyjoyful.com
997
fuli530.com
fuli530.com
fuli530
11
https:// www. fuli530.com
com
fuli530.com
998
findyouraloha.com
findyouraloha.com
findyouraloha
17
https:// www. findyouraloha.com
com
findyouraloha.com
999
financialservicesmarketingsimplified.com
financialservicesmarketingsimplified.com
financialservicesmarketingsimplified
40
https:// www. financialservicesmarketingsimplified.com
com
financialservicesmarketingsimplified.com
1,000
fhacreditrequirements.com
fhacreditrequirements.com
fhacreditrequirements
25
https:// www. fhacreditrequirements.com
com
fhacreditrequirements.com

Previous page (1) | Current page (2) | Next page (3) | All Pages

Last 100 days domain names registered

  1. Tue, 20 Aug, 2019
  2. Mon, 19 Aug, 2019
  3. Sun, 18 Aug, 2019
  4. Sat, 17 Aug, 2019
  5. Fri, 16 Aug, 2019
  6. Thu, 15 Aug, 2019
  7. Wed, 14 Aug, 2019
  8. Tue, 13 Aug, 2019
  9. Mon, 12 Aug, 2019
  10. Sun, 11 Aug, 2019
  11. Sat, 10 Aug, 2019
  12. Fri, 9 Aug, 2019
  13. Thu, 8 Aug, 2019
  14. Wed, 7 Aug, 2019
  15. Tue, 6 Aug, 2019
  16. Mon, 5 Aug, 2019
  17. Sun, 4 Aug, 2019
  18. Sat, 3 Aug, 2019
  19. Fri, 2 Aug, 2019
  20. Thu, 1 Aug, 2019
  21. Wed, 31 Jul, 2019
  22. Tue, 30 Jul, 2019
  23. Mon, 29 Jul, 2019
  24. Sun, 28 Jul, 2019
  25. Sat, 27 Jul, 2019
  26. Fri, 26 Jul, 2019
  27. Thu, 25 Jul, 2019
  28. Wed, 24 Jul, 2019
  29. Tue, 23 Jul, 2019
  30. Mon, 22 Jul, 2019
  31. Sun, 21 Jul, 2019
  32. Sat, 20 Jul, 2019
  33. Fri, 19 Jul, 2019
  34. Thu, 18 Jul, 2019
  35. Wed, 17 Jul, 2019
  36. Tue, 16 Jul, 2019
  37. Mon, 15 Jul, 2019
  38. Sun, 14 Jul, 2019
  39. Sat, 13 Jul, 2019
  40. Fri, 12 Jul, 2019
  41. Thu, 11 Jul, 2019
  42. Wed, 10 Jul, 2019
  43. Tue, 9 Jul, 2019
  44. Mon, 8 Jul, 2019
  45. Sun, 7 Jul, 2019
  46. Sat, 6 Jul, 2019
  47. Fri, 5 Jul, 2019
  48. Thu, 4 Jul, 2019
  49. Wed, 3 Jul, 2019
  50. Tue, 2 Jul, 2019
  51. Mon, 1 Jul, 2019
  52. Sun, 30 Jun, 2019
  53. Sat, 29 Jun, 2019
  54. Fri, 28 Jun, 2019
  55. Thu, 27 Jun, 2019
  56. Wed, 26 Jun, 2019
  57. Tue, 25 Jun, 2019
  58. Mon, 24 Jun, 2019
  59. Sun, 23 Jun, 2019
  60. Sat, 22 Jun, 2019
  61. Fri, 21 Jun, 2019
  62. Thu, 20 Jun, 2019
  63. Wed, 19 Jun, 2019
  64. Tue, 18 Jun, 2019
  65. Mon, 17 Jun, 2019
  66. Sun, 16 Jun, 2019
  67. Sat, 15 Jun, 2019
  68. Fri, 14 Jun, 2019
  69. Thu, 13 Jun, 2019
  70. Wed, 12 Jun, 2019
  71. Tue, 11 Jun, 2019
  72. Mon, 10 Jun, 2019
  73. Sun, 9 Jun, 2019
  74. Sat, 8 Jun, 2019
  75. Fri, 7 Jun, 2019
  76. Thu, 6 Jun, 2019
  77. Wed, 5 Jun, 2019
  78. Tue, 4 Jun, 2019
  79. Mon, 3 Jun, 2019
  80. Sun, 2 Jun, 2019
  81. Sat, 1 Jun, 2019
  82. Fri, 31 May, 2019
  83. Thu, 30 May, 2019
  84. Wed, 29 May, 2019
  85. Tue, 28 May, 2019
  86. Mon, 27 May, 2019
  87. Sun, 26 May, 2019
  88. Sat, 25 May, 2019
  89. Fri, 24 May, 2019
  90. Thu, 23 May, 2019
  91. Wed, 22 May, 2019
  92. Tue, 21 May, 2019
  93. Mon, 20 May, 2019
  94. Sun, 19 May, 2019
  95. Sat, 18 May, 2019
  96. Fri, 17 May, 2019
  97. Thu, 16 May, 2019
  98. Wed, 15 May, 2019
  99. Tue, 14 May, 2019
  100. Mon, 13 May, 2019

Homepage | Privacy Policy

Our sites: Download Apps | Song Lyrics | Submit Articles

Copyright © 2019 Domain Name Registered . All rights reserved.
Cached: IP: 34.239.158.107, 24 August, 2019 12:19:15 (LONDON - UK).

Domain-Name-Registered.Com

All about Domain Name, Domain Tools and Domain Name Database

Free Whois Tool

Check the domain name owner, when it first registration, expire..

Free Domain Checker

Check domain available or not, then can buy or renew or back order

Webpage Header Checker

Free check Webpage Header return thats hidden from users

Daily Domain Name Registration

Free tool to check domain name first registered by day