Domain-Name-Registered.Com

Domain Name Registered on Tuesday Jan 22, 2019 page 2.

There are hundreds of thousands of domains were registered daily, and this place DOMAIN-NAME-REGISTERED.COM is where you can check out almost domains are registered by day. Our domain database is to update list of domains by day, registrar, and extension. Lists contain daily changes (yes, some registrars do register 100k+ domains!). .

Where does this data come from?

All of our data comes from analyzing publicly accessible database from domain registrars. Due to registry restrictions we are only able to download the zones once per day (hence the 48 delay in processing).

#
Domain Name
Main Domain
www
https
Length
Ext
Whois
501
fadcosplay.com
fadcosplay.com
fadcosplay
14
https:// www. fadcosplay.com
com
fadcosplay.com
502
fastfirerecords.com
fastfirerecords.com
fastfirerecords
19
https:// www. fastfirerecords.com
com
fastfirerecords.com
503
fittrainerworld.com
fittrainerworld.com
fittrainerworld
19
https:// www. fittrainerworld.com
com
fittrainerworld.com
504
fetishfashionawards.com
fetishfashionawards.com
fetishfashionawards
23
https:// www. fetishfashionawards.com
com
fetishfashionawards.com
505
fermgrip.com
fermgrip.com
fermgrip
12
https:// www. fermgrip.com
com
fermgrip.com
506
fillplane.com
fillplane.com
fillplane
13
https:// www. fillplane.com
com
fillplane.com
507
flaskcall.com
flaskcall.com
flaskcall
13
https:// www. flaskcall.com
com
flaskcall.com
508
fb-appauth.com
fb-appauth.com
fb-appauth
14
https:// www. fb-appauth.com
com
fb-appauth.com
509
flushingfoo.com
flushingfoo.com
flushingfoo
15
https:// www. flushingfoo.com
com
flushingfoo.com
510
facemcgee.com
facemcgee.com
facemcgee
13
https:// www. facemcgee.com
com
facemcgee.com
511
fjldd.com
fjldd.com
fjldd
9
https:// www. fjldd.com
com
fjldd.com
512
fpkj199.com
fpkj199.com
fpkj199
11
https:// www. fpkj199.com
com
fpkj199.com
513
fxfjj.com
fxfjj.com
fxfjj
9
https:// www. fxfjj.com
com
fxfjj.com
514
favlagu.com
favlagu.com
favlagu
11
https:// www. favlagu.com
com
favlagu.com
515
farfetchs.com
farfetchs.com
farfetchs
13
https:// www. farfetchs.com
com
farfetchs.com
516
fernandomorenojr.com
fernandomorenojr.com
fernandomorenojr
20
https:// www. fernandomorenojr.com
com
fernandomorenojr.com
517
floridabayadventuresinc.com
floridabayadventuresinc.com
floridabayadventuresinc
27
https:// www. floridabayadventuresinc.com
com
floridabayadventuresinc.com
518
flpbywalter.com
flpbywalter.com
flpbywalter
15
https:// www. flpbywalter.com
com
flpbywalter.com
519
fireflychaser.com
fireflychaser.com
fireflychaser
17
https:// www. fireflychaser.com
com
fireflychaser.com
520
fillproperty.com
fillproperty.com
fillproperty
16
https:// www. fillproperty.com
com
fillproperty.com
521
firstbilingualprep.com
firstbilingualprep.com
firstbilingualprep
22
https:// www. firstbilingualprep.com
com
firstbilingualprep.com
522
friendsofkirkleyhall.com
friendsofkirkleyhall.com
friendsofkirkleyhall
24
https:// www. friendsofkirkleyhall.com
com
friendsofkirkleyhall.com
523
fineartichoke.com
fineartichoke.com
fineartichoke
17
https:// www. fineartichoke.com
com
fineartichoke.com
524
fyzhan.com
fyzhan.com
fyzhan
10
https:// www. fyzhan.com
com
fyzhan.com
525
fabricdirectblog.com
fabricdirectblog.com
fabricdirectblog
20
https:// www. fabricdirectblog.com
com
fabricdirectblog.com
526
freenewsz.com
freenewsz.com
freenewsz
13
https:// www. freenewsz.com
com
freenewsz.com
527
files-castle.com
files-castle.com
files-castle
16
https:// www. files-castle.com
com
files-castle.com
528
feihuanyule.com
feihuanyule.com
feihuanyule
15
https:// www. feihuanyule.com
com
feihuanyule.com
529
fourling.com
fourling.com
fourling
12
https:// www. fourling.com
com
fourling.com
530
fanatic-okayama.com
fanatic-okayama.com
fanatic-okayama
19
https:// www. fanatic-okayama.com
com
fanatic-okayama.com
531
fireproofhousing.com
fireproofhousing.com
fireproofhousing
20
https:// www. fireproofhousing.com
com
fireproofhousing.com
532
financierayamamoto.com
financierayamamoto.com
financierayamamoto
22
https:// www. financierayamamoto.com
com
financierayamamoto.com
533
foreigndomesticworkersassociationofamerica.com
foreigndomesticworkersassociationofamerica.com
foreigndomesticworkersassociationofamerica
46
https:// www. foreigndomesticworkersassociationofamerica.com
com
foreigndomesticworkersassociationofamerica.com
534
favesli.com
favesli.com
favesli
11
https:// www. favesli.com
com
favesli.com
535
fashionclothdeals.com
fashionclothdeals.com
fashionclothdeals
21
https:// www. fashionclothdeals.com
com
fashionclothdeals.com
536
freeonlinepennyslotsforfree.com
freeonlinepennyslotsforfree.com
freeonlinepennyslotsforfree
31
https:// www. freeonlinepennyslotsforfree.com
com
freeonlinepennyslotsforfree.com
537
fomaska.com
fomaska.com
fomaska
11
https:// www. fomaska.com
com
fomaska.com
538
freshofout***s.com
freshofout***s.com
freshofoutfucks
19
https:// www. freshofout***s.com
com
freshofoutfucks.com
539
fletesymudanzaswl.com
fletesymudanzaswl.com
fletesymudanzaswl
21
https:// www. fletesymudanzaswl.com
com
fletesymudanzaswl.com
540
foriegnautoimports.com
foriegnautoimports.com
foriegnautoimports
22
https:// www. foriegnautoimports.com
com
foriegnautoimports.com
541
flushingdating.com
flushingdating.com
flushingdating
18
https:// www. flushingdating.com
com
flushingdating.com
542
floridajen.com
floridajen.com
floridajen
14
https:// www. floridajen.com
com
floridajen.com
543
felicialachellesboutique.com
felicialachellesboutique.com
felicialachellesboutique
28
https:// www. felicialachellesboutique.com
com
felicialachellesboutique.com
544
foodiu.com
foodiu.com
foodiu
10
https:// www. foodiu.com
com
foodiu.com
545
fitexpertone.com
fitexpertone.com
fitexpertone
16
https:// www. fitexpertone.com
com
fitexpertone.com
546
foxsoirts.com
foxsoirts.com
foxsoirts
13
https:// www. foxsoirts.com
com
foxsoirts.com
547
fjzbjt.com
fjzbjt.com
fjzbjt
10
https:// www. fjzbjt.com
com
fjzbjt.com
548
freesunglassesonline.com
freesunglassesonline.com
freesunglassesonline
24
https:// www. freesunglassesonline.com
com
freesunglassesonline.com
549
fityantra.com
fityantra.com
fityantra
13
https:// www. fityantra.com
com
fityantra.com
550
floridalandassociates.com
floridalandassociates.com
floridalandassociates
25
https:// www. floridalandassociates.com
com
floridalandassociates.com
551
fraifrais.com
fraifrais.com
fraifrais
13
https:// www. fraifrais.com
com
fraifrais.com
552
f74ypb.com
f74ypb.com
f74ypb
10
https:// www. f74ypb.com
com
f74ypb.com
553
fitfirestudios.com
fitfirestudios.com
fitfirestudios
18
https:// www. fitfirestudios.com
com
fitfirestudios.com
554
floridainternationaltravelexpo.com
floridainternationaltravelexpo.com
floridainternationaltravelexpo
34
https:// www. floridainternationaltravelexpo.com
com
floridainternationaltravelexpo.com
555
fuli530.com
fuli530.com
fuli530
11
https:// www. fuli530.com
com
fuli530.com
556
firesidefamily.com
firesidefamily.com
firesidefamily
18
https:// www. firesidefamily.com
com
firesidefamily.com
557
flete-seguro.com
flete-seguro.com
flete-seguro
16
https:// www. flete-seguro.com
com
flete-seguro.com
558
fabkf.com
fabkf.com
fabkf
9
https:// www. fabkf.com
com
fabkf.com
559
fishydesigns.com
fishydesigns.com
fishydesigns
16
https:// www. fishydesigns.com
com
fishydesigns.com
560
fabbylists.com
fabbylists.com
fabbylists
14
https:// www. fabbylists.com
com
fabbylists.com
561
ffqq6789.com
ffqq6789.com
ffqq6789
12
https:// www. ffqq6789.com
com
ffqq6789.com
562
faithresults.com
faithresults.com
faithresults
16
https:// www. faithresults.com
com
faithresults.com
563
fjjsjyw.com
fjjsjyw.com
fjjsjyw
11
https:// www. fjjsjyw.com
com
fjjsjyw.com
564
floatinggemstone.com
floatinggemstone.com
floatinggemstone
20
https:// www. floatinggemstone.com
com
floatinggemstone.com
565
fianceexpress.com
fianceexpress.com
fianceexpress
17
https:// www. fianceexpress.com
com
fianceexpress.com
566
feigseoa.com
feigseoa.com
feigseoa
12
https:// www. feigseoa.com
com
feigseoa.com
567
fascnations.com
fascnations.com
fascnations
15
https:// www. fascnations.com
com
fascnations.com
568
fsmaweebly.com
fsmaweebly.com
fsmaweebly
14
https:// www. fsmaweebly.com
com
fsmaweebly.com
569
firezz.com
firezz.com
firezz
10
https:// www. firezz.com
com
firezz.com
570
fujikin-usa.com
fujikin-usa.com
fujikin-usa
15
https:// www. fujikin-usa.com
com
fujikin-usa.com
571
feedbackcaller.com
feedbackcaller.com
feedbackcaller
18
https:// www. feedbackcaller.com
com
feedbackcaller.com
572
fordfanhalloffame.com
fordfanhalloffame.com
fordfanhalloffame
21
https:// www. fordfanhalloffame.com
com
fordfanhalloffame.com
573
fancy4fun.com
fancy4fun.com
fancy4fun
13
https:// www. fancy4fun.com
com
fancy4fun.com
574
freres-et-soeurs.com
freres-et-soeurs.com
freres-et-soeurs
20
https:// www. freres-et-soeurs.com
com
freres-et-soeurs.com
575
fxtplatform.com
fxtplatform.com
fxtplatform
15
https:// www. fxtplatform.com
com
fxtplatform.com
576
footselect.com
footselect.com
footselect
14
https:// www. footselect.com
com
footselect.com
577
fortnightworlds.com
fortnightworlds.com
fortnightworlds
19
https:// www. fortnightworlds.com
com
fortnightworlds.com
578
fireveg.com
fireveg.com
fireveg
11
https:// www. fireveg.com
com
fireveg.com
579
friendlyfin.com
friendlyfin.com
friendlyfin
15
https:// www. friendlyfin.com
com
friendlyfin.com
580
famille-roch.com
famille-roch.com
famille-roch
16
https:// www. famille-roch.com
com
famille-roch.com
581
forrestersinvestors.com
forrestersinvestors.com
forrestersinvestors
23
https:// www. forrestersinvestors.com
com
forrestersinvestors.com
582
fashioncityshop.com
fashioncityshop.com
fashioncityshop
19
https:// www. fashioncityshop.com
com
fashioncityshop.com
583
fabulashz.com
fabulashz.com
fabulashz
13
https:// www. fabulashz.com
com
fabulashz.com
584
figsandpoppies.com
figsandpoppies.com
figsandpoppies
18
https:// www. figsandpoppies.com
com
figsandpoppies.com
585
fd8sam.com
fd8sam.com
fd8sam
10
https:// www. fd8sam.com
com
fd8sam.com
586
fourcreek.com
fourcreek.com
fourcreek
13
https:// www. fourcreek.com
com
fourcreek.com
587
fbcgglenarden.com
fbcgglenarden.com
fbcgglenarden
17
https:// www. fbcgglenarden.com
com
fbcgglenarden.com
588
frequencyofprovision.com
frequencyofprovision.com
frequencyofprovision
24
https:// www. frequencyofprovision.com
com
frequencyofprovision.com
589
fanryes.com
fanryes.com
fanryes
11
https:// www. fanryes.com
com
fanryes.com
590
fancyloves.com
fancyloves.com
fancyloves
14
https:// www. fancyloves.com
com
fancyloves.com
591
flippitydippity.com
flippitydippity.com
flippitydippity
19
https:// www. flippitydippity.com
com
flippitydippity.com
592
fireuplife.com
fireuplife.com
fireuplife
14
https:// www. fireuplife.com
com
fireuplife.com
593
floridatheseries.com
floridatheseries.com
floridatheseries
20
https:// www. floridatheseries.com
com
floridatheseries.com
594
firetvsticktricks.com
firetvsticktricks.com
firetvsticktricks
21
https:// www. firetvsticktricks.com
com
firetvsticktricks.com
595
foltonbank.com
foltonbank.com
foltonbank
14
https:// www. foltonbank.com
com
foltonbank.com
596
flatshareseries.com
flatshareseries.com
flatshareseries
19
https:// www. flatshareseries.com
com
flatshareseries.com
597
fjqhjd.com
fjqhjd.com
fjqhjd
10
https:// www. fjqhjd.com
com
fjqhjd.com
598
felizsigloxxi.com
felizsigloxxi.com
felizsigloxxi
17
https:// www. felizsigloxxi.com
com
felizsigloxxi.com
599
familyfarmblitar.com
familyfarmblitar.com
familyfarmblitar
20
https:// www. familyfarmblitar.com
com
familyfarmblitar.com
600
frenzyandco.com
frenzyandco.com
frenzyandco
15
https:// www. frenzyandco.com
com
frenzyandco.com
601
funnyyoushouldasktv.com
funnyyoushouldasktv.com
funnyyoushouldasktv
23
https:// www. funnyyoushouldasktv.com
com
funnyyoushouldasktv.com
602
fuzhoupfk.com
fuzhoupfk.com
fuzhoupfk
13
https:// www. fuzhoupfk.com
com
fuzhoupfk.com
603
fluidflushsystems.com
fluidflushsystems.com
fluidflushsystems
21
https:// www. fluidflushsystems.com
com
fluidflushsystems.com
604
freegagent.com
freegagent.com
freegagent
14
https:// www. freegagent.com
com
freegagent.com
605
fc-bb9uhk5hbw.com
fc-bb9uhk5hbw.com
fc-bb9uhk5hbw
17
https:// www. fc-bb9uhk5hbw.com
com
fc-bb9uhk5hbw.com
606
fairhavenband.com
fairhavenband.com
fairhavenband
17
https:// www. fairhavenband.com
com
fairhavenband.com
607
fontes-sequana.com
fontes-sequana.com
fontes-sequana
18
https:// www. fontes-sequana.com
com
fontes-sequana.com
608
fjcxjsw.com
fjcxjsw.com
fjcxjsw
11
https:// www. fjcxjsw.com
com
fjcxjsw.com
609
finghers.com
finghers.com
finghers
12
https:// www. finghers.com
com
finghers.com
610
freerealestatemoney.com
freerealestatemoney.com
freerealestatemoney
23
https:// www. freerealestatemoney.com
com
freerealestatemoney.com
611
finforensicsja.com
finforensicsja.com
finforensicsja
18
https:// www. finforensicsja.com
com
finforensicsja.com
612
flooringcampbell.com
flooringcampbell.com
flooringcampbell
20
https:// www. flooringcampbell.com
com
flooringcampbell.com
613
fruitshade.com
fruitshade.com
fruitshade
14
https:// www. fruitshade.com
com
fruitshade.com
614
fortierboatsinc.com
fortierboatsinc.com
fortierboatsinc
19
https:// www. fortierboatsinc.com
com
fortierboatsinc.com
615
fukenko.com
fukenko.com
fukenko
11
https:// www. fukenko.com
com
fukenko.com
616
ferreyrolaundryservice.com
ferreyrolaundryservice.com
ferreyrolaundryservice
26
https:// www. ferreyrolaundryservice.com
com
ferreyrolaundryservice.com
617
forgoodmoney.com
forgoodmoney.com
forgoodmoney
16
https:// www. forgoodmoney.com
com
forgoodmoney.com
618
fsfwjs.com
fsfwjs.com
fsfwjs
10
https:// www. fsfwjs.com
com
fsfwjs.com
619
fullbul.com
fullbul.com
fullbul
11
https:// www. fullbul.com
com
fullbul.com
620
familybotanicalcompany.com
familybotanicalcompany.com
familybotanicalcompany
26
https:// www. familybotanicalcompany.com
com
familybotanicalcompany.com
621
foodtruckroute.com
foodtruckroute.com
foodtruckroute
18
https:// www. foodtruckroute.com
com
foodtruckroute.com
622
foodindustryena.com
foodindustryena.com
foodindustryena
19
https:// www. foodindustryena.com
com
foodindustryena.com
623
flordiageorgialine.com
flordiageorgialine.com
flordiageorgialine
22
https:// www. flordiageorgialine.com
com
flordiageorgialine.com
624
fastcashoffernc.com
fastcashoffernc.com
fastcashoffernc
19
https:// www. fastcashoffernc.com
com
fastcashoffernc.com
625
faqos.com
faqos.com
faqos
9
https:// www. faqos.com
com
faqos.com
626
fortvuck.com
fortvuck.com
fortvuck
12
https:// www. fortvuck.com
com
fortvuck.com
627
fpinfra.com
fpinfra.com
fpinfra
11
https:// www. fpinfra.com
com
fpinfra.com
628
freeibookstemplates.com
freeibookstemplates.com
freeibookstemplates
23
https:// www. freeibookstemplates.com
com
freeibookstemplates.com
629
finstroyinvest.com
finstroyinvest.com
finstroyinvest
18
https:// www. finstroyinvest.com
com
finstroyinvest.com
630
faithfullyjoyful.com
faithfullyjoyful.com
faithfullyjoyful
20
https:// www. faithfullyjoyful.com
com
faithfullyjoyful.com
631
funkclone.com
funkclone.com
funkclone
13
https:// www. funkclone.com
com
funkclone.com
632
flordiaapartmentphotos.com
flordiaapartmentphotos.com
flordiaapartmentphotos
26
https:// www. flordiaapartmentphotos.com
com
flordiaapartmentphotos.com
633
fortressraid.com
fortressraid.com
fortressraid
16
https:// www. fortressraid.com
com
fortressraid.com
634
finisity.com
finisity.com
finisity
12
https:// www. finisity.com
com
finisity.com
635
forodelseo.com
forodelseo.com
forodelseo
14
https:// www. forodelseo.com
com
forodelseo.com
636
fortunefindersinc.com
fortunefindersinc.com
fortunefindersinc
21
https:// www. fortunefindersinc.com
com
fortunefindersinc.com
637
f7420.com
f7420.com
f7420
9
https:// www. f7420.com
com
f7420.com
638
flamingoautotransport.com
flamingoautotransport.com
flamingoautotransport
25
https:// www. flamingoautotransport.com
com
flamingoautotransport.com
639
firstsbankcard.com
firstsbankcard.com
firstsbankcard
18
https:// www. firstsbankcard.com
com
firstsbankcard.com
640
farmerknee.com
farmerknee.com
farmerknee
14
https:// www. farmerknee.com
com
farmerknee.com
641
findinghalcyon.com
findinghalcyon.com
findinghalcyon
18
https:// www. findinghalcyon.com
com
findinghalcyon.com
642
footballsfield.com
footballsfield.com
footballsfield
18
https:// www. footballsfield.com
com
footballsfield.com
643
fysinvestments.com
fysinvestments.com
fysinvestments
18
https:// www. fysinvestments.com
com
fysinvestments.com
644
fonsee.com
fonsee.com
fonsee
10
https:// www. fonsee.com
com
fonsee.com
645
forexprospect.com
forexprospect.com
forexprospect
17
https:// www. forexprospect.com
com
forexprospect.com
646
fbbjy.com
fbbjy.com
fbbjy
9
https:// www. fbbjy.com
com
fbbjy.com
647
fosteredlove.com
fosteredlove.com
fosteredlove
16
https:// www. fosteredlove.com
com
fosteredlove.com
648
ferherty.com
ferherty.com
ferherty
12
https:// www. ferherty.com
com
ferherty.com
649
firstbead.com
firstbead.com
firstbead
13
https:// www. firstbead.com
com
firstbead.com
650
femdomepire.com
femdomepire.com
femdomepire
15
https:// www. femdomepire.com
com
femdomepire.com
651
forwardgravel.com
forwardgravel.com
forwardgravel
17
https:// www. forwardgravel.com
com
forwardgravel.com
652
financialtwins.com
financialtwins.com
financialtwins
18
https:// www. financialtwins.com
com
financialtwins.com
653
flitrosguadalajara.com
flitrosguadalajara.com
flitrosguadalajara
22
https:// www. flitrosguadalajara.com
com
flitrosguadalajara.com
654
farfromelementary.com
farfromelementary.com
farfromelementary
21
https:// www. farfromelementary.com
com
farfromelementary.com
655
fscbm.com
fscbm.com
fscbm
9
https:// www. fscbm.com
com
fscbm.com
656
fitfedclub.com
fitfedclub.com
fitfedclub
14
https:// www. fitfedclub.com
com
fitfedclub.com
657
fabswomgers.com
fabswomgers.com
fabswomgers
15
https:// www. fabswomgers.com
com
fabswomgers.com
658
findsfunkyresale.com
findsfunkyresale.com
findsfunkyresale
20
https:// www. findsfunkyresale.com
com
findsfunkyresale.com
659
fullmovienew.com
fullmovienew.com
fullmovienew
16
https:// www. fullmovienew.com
com
fullmovienew.com
660
forbiddensnack.com
forbiddensnack.com
forbiddensnack
18
https:// www. forbiddensnack.com
com
forbiddensnack.com
661
funlolpics.com
funlolpics.com
funlolpics
14
https:// www. funlolpics.com
com
funlolpics.com
662
feedachildevents.com
feedachildevents.com
feedachildevents
20
https:// www. feedachildevents.com
com
feedachildevents.com
663
farizchowdhury.com
farizchowdhury.com
farizchowdhury
18
https:// www. farizchowdhury.com
com
farizchowdhury.com
664
flightcloser.com
flightcloser.com
flightcloser
16
https:// www. flightcloser.com
com
flightcloser.com
665
ffff520.com
ffff520.com
ffff520
11
https:// www. ffff520.com
com
ffff520.com
666
felixbacik.com
felixbacik.com
felixbacik
14
https:// www. felixbacik.com
com
felixbacik.com
667
fhjgjhdfkjds.com
fhjgjhdfkjds.com
fhjgjhdfkjds
16
https:// www. fhjgjhdfkjds.com
com
fhjgjhdfkjds.com
668
floretteskincare.com
floretteskincare.com
floretteskincare
20
https:// www. floretteskincare.com
com
floretteskincare.com
669
facthus.com
facthus.com
facthus
11
https:// www. facthus.com
com
facthus.com
670
fitnessbootcampaustin.com
fitnessbootcampaustin.com
fitnessbootcampaustin
25
https:// www. fitnessbootcampaustin.com
com
fitnessbootcampaustin.com
671
fortsaskatchewaninsurance.com
fortsaskatchewaninsurance.com
fortsaskatchewaninsurance
29
https:// www. fortsaskatchewaninsurance.com
com
fortsaskatchewaninsurance.com
672
frstnews.com
frstnews.com
frstnews
12
https:// www. frstnews.com
com
frstnews.com
673
fogeloch.com
fogeloch.com
fogeloch
12
https:// www. fogeloch.com
com
fogeloch.com
674
free-fitting-room.com
free-fitting-room.com
free-fitting-room
21
https:// www. free-fitting-room.com
com
free-fitting-room.com
675
fwengyl.com
fwengyl.com
fwengyl
11
https:// www. fwengyl.com
com
fwengyl.com
676
foryourpreciouspet.com
foryourpreciouspet.com
foryourpreciouspet
22
https:// www. foryourpreciouspet.com
com
foryourpreciouspet.com
677
fjdjwx.com
fjdjwx.com
fjdjwx
10
https:// www. fjdjwx.com
com
fjdjwx.com
678
fibrofitandhealthy.com
fibrofitandhealthy.com
fibrofitandhealthy
22
https:// www. fibrofitandhealthy.com
com
fibrofitandhealthy.com
679
fairfaxcosmeticsurgery.com
fairfaxcosmeticsurgery.com
fairfaxcosmeticsurgery
26
https:// www. fairfaxcosmeticsurgery.com
com
fairfaxcosmeticsurgery.com
680
fjdak.com
fjdak.com
fjdak
9
https:// www. fjdak.com
com
fjdak.com
681
fgxbgr.com
fgxbgr.com
fgxbgr
10
https:// www. fgxbgr.com
com
fgxbgr.com
682
falconsneakpeek.com
falconsneakpeek.com
falconsneakpeek
19
https:// www. falconsneakpeek.com
com
falconsneakpeek.com
683
fourlinesofcode.com
fourlinesofcode.com
fourlinesofcode
19
https:// www. fourlinesofcode.com
com
fourlinesofcode.com
684
fitontheroad.com
fitontheroad.com
fitontheroad
16
https:// www. fitontheroad.com
com
fitontheroad.com
685
foreverhjs.com
foreverhjs.com
foreverhjs
14
https:// www. foreverhjs.com
com
foreverhjs.com
686
fliincus.com
fliincus.com
fliincus
12
https:// www. fliincus.com
com
fliincus.com
687
floridahomemortgageloans.com
floridahomemortgageloans.com
floridahomemortgageloans
28
https:// www. floridahomemortgageloans.com
com
floridahomemortgageloans.com
688
fluffytots.com
fluffytots.com
fluffytots
14
https:// www. fluffytots.com
com
fluffytots.com
689
faithesis.com
faithesis.com
faithesis
13
https:// www. faithesis.com
com
faithesis.com
690
firstrungcrypto.com
firstrungcrypto.com
firstrungcrypto
19
https:// www. firstrungcrypto.com
com
firstrungcrypto.com
691
fortifiedink.com
fortifiedink.com
fortifiedink
16
https:// www. fortifiedink.com
com
fortifiedink.com
692
formerkh.com
formerkh.com
formerkh
12
https:// www. formerkh.com
com
formerkh.com
693
floodprotectionmadesimple.com
floodprotectionmadesimple.com
floodprotectionmadesimple
29
https:// www. floodprotectionmadesimple.com
com
floodprotectionmadesimple.com
694
filmautotech.com
filmautotech.com
filmautotech
16
https:// www. filmautotech.com
com
filmautotech.com
695
freemax360.com
freemax360.com
freemax360
14
https:// www. freemax360.com
com
freemax360.com
696
fracters.com
fracters.com
fracters
12
https:// www. fracters.com
com
fracters.com
697
fideliascare.com
fideliascare.com
fideliascare
16
https:// www. fideliascare.com
com
fideliascare.com
698
fo3ir.com
fo3ir.com
fo3ir
9
https:// www. fo3ir.com
com
fo3ir.com
699
flc-home.com
flc-home.com
flc-home
12
https:// www. flc-home.com
com
flc-home.com
700
fallenlemmings.com
fallenlemmings.com
fallenlemmings
18
https:// www. fallenlemmings.com
com
fallenlemmings.com
701
fewoluedenscheid.com
fewoluedenscheid.com
fewoluedenscheid
20
https:// www. fewoluedenscheid.com
com
fewoluedenscheid.com
702
felloffdatruck.com
felloffdatruck.com
felloffdatruck
18
https:// www. felloffdatruck.com
com
felloffdatruck.com
703
florxpress.com
florxpress.com
florxpress
14
https:// www. florxpress.com
com
florxpress.com
704
forwardinghelp.com
forwardinghelp.com
forwardinghelp
18
https:// www. forwardinghelp.com
com
forwardinghelp.com
705
forexbotplus.com
forexbotplus.com
forexbotplus
16
https:// www. forexbotplus.com
com
forexbotplus.com
706
findingikigaii.com
findingikigaii.com
findingikigaii
18
https:// www. findingikigaii.com
com
findingikigaii.com
707
fkrdviscs.com
fkrdviscs.com
fkrdviscs
13
https:// www. fkrdviscs.com
com
fkrdviscs.com
708
freeonlinepaper.com
freeonlinepaper.com
freeonlinepaper
19
https:// www. freeonlinepaper.com
com
freeonlinepaper.com
709
forexgto.com
forexgto.com
forexgto
12
https:// www. forexgto.com
com
forexgto.com
710
fanrad.com
fanrad.com
fanrad
10
https:// www. fanrad.com
com
fanrad.com
711
foxfarmnursery.com
foxfarmnursery.com
foxfarmnursery
18
https:// www. foxfarmnursery.com
com
foxfarmnursery.com
712
fwyjj.com
fwyjj.com
fwyjj
9
https:// www. fwyjj.com
com
fwyjj.com
713
fuzhouxisu.com
fuzhouxisu.com
fuzhouxisu
14
https:// www. fuzhouxisu.com
com
fuzhouxisu.com
714
frenchmgmt.com
frenchmgmt.com
frenchmgmt
14
https:// www. frenchmgmt.com
com
frenchmgmt.com
715
franciscoresendiz.com
franciscoresendiz.com
franciscoresendiz
21
https:// www. franciscoresendiz.com
com
franciscoresendiz.com
716
flashforwardevents.com
flashforwardevents.com
flashforwardevents
22
https:// www. flashforwardevents.com
com
flashforwardevents.com
717
fix-my-tech.com
fix-my-tech.com
fix-my-tech
15
https:// www. fix-my-tech.com
com
fix-my-tech.com
718
fitbydrsmith.com
fitbydrsmith.com
fitbydrsmith
16
https:// www. fitbydrsmith.com
com
fitbydrsmith.com
719
fsfous.com
fsfous.com
fsfous
10
https:// www. fsfous.com
com
fsfous.com
720
fannysfurniturekelowna.com
fannysfurniturekelowna.com
fannysfurniturekelowna
26
https:// www. fannysfurniturekelowna.com
com
fannysfurniturekelowna.com
721
fys9.com
fys9.com
fys9
8
https:// www. fys9.com
com
fys9.com
722
fitnesszonedesk.com
fitnesszonedesk.com
fitnesszonedesk
19
https:// www. fitnesszonedesk.com
com
fitnesszonedesk.com
723
fitgelmalaysia.com
fitgelmalaysia.com
fitgelmalaysia
18
https:// www. fitgelmalaysia.com
com
fitgelmalaysia.com
724
fthsd.com
fthsd.com
fthsd
9
https:// www. fthsd.com
com
fthsd.com
725
foreclosureemergency.com
foreclosureemergency.com
foreclosureemergency
24
https:// www. foreclosureemergency.com
com
foreclosureemergency.com
726
fivetrader.com
fivetrader.com
fivetrader
14
https:// www. fivetrader.com
com
fivetrader.com
727
fillbroadway.com
fillbroadway.com
fillbroadway
16
https:// www. fillbroadway.com
com
fillbroadway.com
728
fadacailiuliu7.com
fadacailiuliu7.com
fadacailiuliu7
18
https:// www. fadacailiuliu7.com
com
fadacailiuliu7.com
729
fatehjangmart.com
fatehjangmart.com
fatehjangmart
17
https:// www. fatehjangmart.com
com
fatehjangmart.com
730
freelancefemmes.com
freelancefemmes.com
freelancefemmes
19
https:// www. freelancefemmes.com
com
freelancefemmes.com
731
frischfrostservice.com
frischfrostservice.com
frischfrostservice
22
https:// www. frischfrostservice.com
com
frischfrostservice.com
732
franespejo.com
franespejo.com
franespejo
14
https:// www. franespejo.com
com
franespejo.com
733
fkzj84.com
fkzj84.com
fkzj84
10
https:// www. fkzj84.com
com
fkzj84.com
734
fltonbank.com
fltonbank.com
fltonbank
13
https:// www. fltonbank.com
com
fltonbank.com
735
footballprocoaching.com
footballprocoaching.com
footballprocoaching
23
https:// www. footballprocoaching.com
com
footballprocoaching.com
736
filamcrc.com
filamcrc.com
filamcrc
12
https:// www. filamcrc.com
com
filamcrc.com
737
freyjaha.com
freyjaha.com
freyjaha
12
https:// www. freyjaha.com
com
freyjaha.com
738
freeflixac.com
freeflixac.com
freeflixac
14
https:// www. freeflixac.com
com
freeflixac.com
739
flm7788.com
flm7788.com
flm7788
11
https:// www. flm7788.com
com
flm7788.com
740
f3000d.com
f3000d.com
f3000d
10
https:// www. f3000d.com
com
f3000d.com
741
fellnew.com
fellnew.com
fellnew
11
https:// www. fellnew.com
com
fellnew.com
742
fpsmy.com
fpsmy.com
fpsmy
9
https:// www. fpsmy.com
com
fpsmy.com
743
fifa19freebies.com
fifa19freebies.com
fifa19freebies
18
https:// www. fifa19freebies.com
com
fifa19freebies.com
744
freefurnancenj.com
freefurnancenj.com
freefurnancenj
18
https:// www. freefurnancenj.com
com
freefurnancenj.com
745
futureindiapay.com
futureindiapay.com
futureindiapay
18
https:// www. futureindiapay.com
com
futureindiapay.com
746
flugplanung.com
flugplanung.com
flugplanung
15
https:// www. flugplanung.com
com
flugplanung.com
747
fayxsm.com
fayxsm.com
fayxsm
10
https:// www. fayxsm.com
com
fayxsm.com
748
fyscf.com
fyscf.com
fyscf
9
https:// www. fyscf.com
com
fyscf.com
749
fdcyq8.com
fdcyq8.com
fdcyq8
10
https:// www. fdcyq8.com
com
fdcyq8.com
750
fashionshopks.com
fashionshopks.com
fashionshopks
17
https:// www. fashionshopks.com
com
fashionshopks.com
751
floydbrownmusic.com
floydbrownmusic.com
floydbrownmusic
19
https:// www. floydbrownmusic.com
com
floydbrownmusic.com
752
floridahomepb.com
floridahomepb.com
floridahomepb
17
https:// www. floridahomepb.com
com
floridahomepb.com
753
fithealthybest.com
fithealthybest.com
fithealthybest
18
https:// www. fithealthybest.com
com
fithealthybest.com
754
fbcjj.com
fbcjj.com
fbcjj
9
https:// www. fbcjj.com
com
fbcjj.com
755
firstsavingss.com
firstsavingss.com
firstsavingss
17
https:// www. firstsavingss.com
com
firstsavingss.com
756
fngigz.com
fngigz.com
fngigz
10
https:// www. fngigz.com
com
fngigz.com
757
freedomcyclist.com
freedomcyclist.com
freedomcyclist
18
https:// www. freedomcyclist.com
com
freedomcyclist.com
758
freesupershot.com
freesupershot.com
freesupershot
17
https:// www. freesupershot.com
com
freesupershot.com
759
fill***.com
fill***.com
fillsex
11
https:// www. fill***.com
com
fillsex.com
760
forkonomy.com
forkonomy.com
forkonomy
13
https:// www. forkonomy.com
com
forkonomy.com
761
feritnuhoglu.com
feritnuhoglu.com
feritnuhoglu
16
https:// www. feritnuhoglu.com
com
feritnuhoglu.com
762
fluffyrufflesboutique.com
fluffyrufflesboutique.com
fluffyrufflesboutique
25
https:// www. fluffyrufflesboutique.com
com
fluffyrufflesboutique.com
763
fundamentaltoys.com
fundamentaltoys.com
fundamentaltoys
19
https:// www. fundamentaltoys.com
com
fundamentaltoys.com
764
foresightquality.com
foresightquality.com
foresightquality
20
https:// www. foresightquality.com
com
foresightquality.com
765
farhack.com
farhack.com
farhack
11
https:// www. farhack.com
com
farhack.com
766
firstbaptistsouthhill.com
firstbaptistsouthhill.com
firstbaptistsouthhill
25
https:// www. firstbaptistsouthhill.com
com
firstbaptistsouthhill.com
767
fujiadata.com
fujiadata.com
fujiadata
13
https:// www. fujiadata.com
com
fujiadata.com
768
ferienwohnung-mali-losinj.com
ferienwohnung-mali-losinj.com
ferienwohnung-mali-losinj
29
https:// www. ferienwohnung-mali-losinj.com
com
ferienwohnung-mali-losinj.com
769
fortunegourmetchinese.com
fortunegourmetchinese.com
fortunegourmetchinese
25
https:// www. fortunegourmetchinese.com
com
fortunegourmetchinese.com
770
floridainvestorsrealty.com
floridainvestorsrealty.com
floridainvestorsrealty
26
https:// www. floridainvestorsrealty.com
com
floridainvestorsrealty.com
771
franceappeler.com
franceappeler.com
franceappeler
17
https:// www. franceappeler.com
com
franceappeler.com
772
funachina.com
funachina.com
funachina
13
https:// www. funachina.com
com
funachina.com
773
fortune-g-hk.com
fortune-g-hk.com
fortune-g-hk
16
https:// www. fortune-g-hk.com
com
fortune-g-hk.com
774
flikzer.com
flikzer.com
flikzer
11
https:// www. flikzer.com
com
flikzer.com
775
fastholerunning.com
fastholerunning.com
fastholerunning
19
https:// www. fastholerunning.com
com
fastholerunning.com
776
fm12315.com
fm12315.com
fm12315
11
https:// www. fm12315.com
com
fm12315.com
777
factapi.com
factapi.com
factapi
11
https:// www. factapi.com
com
factapi.com
778
figurewood.com
figurewood.com
figurewood
14
https:// www. figurewood.com
com
figurewood.com
779
formothersatkaust.com
formothersatkaust.com
formothersatkaust
21
https:// www. formothersatkaust.com
com
formothersatkaust.com
780
fernandonatalici.com
fernandonatalici.com
fernandonatalici
20
https:// www. fernandonatalici.com
com
fernandonatalici.com
781
findlovematchmaking.com
findlovematchmaking.com
findlovematchmaking
23
https:// www. findlovematchmaking.com
com
findlovematchmaking.com
782
federalnewsrado.com
federalnewsrado.com
federalnewsrado
19
https:// www. federalnewsrado.com
com
federalnewsrado.com
783
futureeyeeartificialintelligence.com
futureeyeeartificialintelligence.com
futureeyeeartificialintelligence
36
https:// www. futureeyeeartificialintelligence.com
com
futureeyeeartificialintelligence.com
784
fashionflatlayz.com
fashionflatlayz.com
fashionflatlayz
19
https:// www. fashionflatlayz.com
com
fashionflatlayz.com
785
figuredeal.com
figuredeal.com
figuredeal
14
https:// www. figuredeal.com
com
figuredeal.com
786
fakepsot.com
fakepsot.com
fakepsot
12
https:// www. fakepsot.com
com
fakepsot.com
787
flawlessoffers.com
flawlessoffers.com
flawlessoffers
18
https:// www. flawlessoffers.com
com
flawlessoffers.com
788
fkpfhzj.com
fkpfhzj.com
fkpfhzj
11
https:// www. fkpfhzj.com
com
fkpfhzj.com
789
favorp.com
favorp.com
favorp
10
https:// www. favorp.com
com
favorp.com
790
faravarf.com
faravarf.com
faravarf
12
https:// www. faravarf.com
com
faravarf.com
791
foxtau.com
foxtau.com
foxtau
10
https:// www. foxtau.com
com
foxtau.com
792
fluahingbank.com
fluahingbank.com
fluahingbank
16
https:// www. fluahingbank.com
com
fluahingbank.com
793
fringefinance.com
fringefinance.com
fringefinance
17
https:// www. fringefinance.com
com
fringefinance.com
794
firfold.com
firfold.com
firfold
11
https:// www. firfold.com
com
firfold.com
795
fotocostantini.com
fotocostantini.com
fotocostantini
18
https:// www. fotocostantini.com
com
fotocostantini.com
796
fraumerle.com
fraumerle.com
fraumerle
13
https:// www. fraumerle.com
com
fraumerle.com
797
flowergirlsandmore.com
flowergirlsandmore.com
flowergirlsandmore
22
https:// www. flowergirlsandmore.com
com
flowergirlsandmore.com
798
foyerrealty.com
foyerrealty.com
foyerrealty
15
https:// www. foyerrealty.com
com
foyerrealty.com
799
fastrealestatesales.com
fastrealestatesales.com
fastrealestatesales
23
https:// www. fastrealestatesales.com
com
fastrealestatesales.com
800
flurofun.com
flurofun.com
flurofun
12
https:// www. flurofun.com
com
flurofun.com
801
fugiwichita.com
fugiwichita.com
fugiwichita
15
https:// www. fugiwichita.com
com
fugiwichita.com
802
foeg4ng.com
foeg4ng.com
foeg4ng
11
https:// www. foeg4ng.com
com
foeg4ng.com
803
fourmatix.com
fourmatix.com
fourmatix
13
https:// www. fourmatix.com
com
fourmatix.com
804
felicegarcia.com
felicegarcia.com
felicegarcia
16
https:// www. felicegarcia.com
com
felicegarcia.com
805
fahrtalent.com
fahrtalent.com
fahrtalent
14
https:// www. fahrtalent.com
com
fahrtalent.com
806
fenshi520.com
fenshi520.com
fenshi520
13
https:// www. fenshi520.com
com
fenshi520.com
807
fernando-store.com
fernando-store.com
fernando-store
18
https:// www. fernando-store.com
com
fernando-store.com
808
fsshuo.com
fsshuo.com
fsshuo
10
https:// www. fsshuo.com
com
fsshuo.com
809
fs-xingchen.com
fs-xingchen.com
fs-xingchen
15
https:// www. fs-xingchen.com
com
fs-xingchen.com
810
fx160.com
fx160.com
fx160
9
https:// www. fx160.com
com
fx160.com
811
ffjzb.com
ffjzb.com
ffjzb
9
https:// www. ffjzb.com
com
ffjzb.com
812
fundsaccntsolutions.com
fundsaccntsolutions.com
fundsaccntsolutions
23
https:// www. fundsaccntsolutions.com
com
fundsaccntsolutions.com
813
fsgholding.com
fsgholding.com
fsgholding
14
https:// www. fsgholding.com
com
fsgholding.com
814
forexkon.com
forexkon.com
forexkon
12
https:// www. forexkon.com
com
forexkon.com
815
floorcleaningjacksonville.com
floorcleaningjacksonville.com
floorcleaningjacksonville
29
https:// www. floorcleaningjacksonville.com
com
floorcleaningjacksonville.com
816
fdacs-hemp.com
fdacs-hemp.com
fdacs-hemp
14
https:// www. fdacs-hemp.com
com
fdacs-hemp.com
817
fastestponies.com
fastestponies.com
fastestponies
17
https:// www. fastestponies.com
com
fastestponies.com
818
fromthebloc.com
fromthebloc.com
fromthebloc
15
https:// www. fromthebloc.com
com
fromthebloc.com
819
freesehomeinspections.com
freesehomeinspections.com
freesehomeinspections
25
https:// www. freesehomeinspections.com
com
freesehomeinspections.com
820
fleksitariskmat.com
fleksitariskmat.com
fleksitariskmat
19
https:// www. fleksitariskmat.com
com
fleksitariskmat.com
821
freecreditscore2go.com
freecreditscore2go.com
freecreditscore2go
22
https:// www. freecreditscore2go.com
com
freecreditscore2go.com
822
fairytaledates.com
fairytaledates.com
fairytaledates
18
https:// www. fairytaledates.com
com
fairytaledates.com
823
fujairahrun.com
fujairahrun.com
fujairahrun
15
https:// www. fujairahrun.com
com
fujairahrun.com
824
fitomart.com
fitomart.com
fitomart
12
https:// www. fitomart.com
com
fitomart.com
825
fbdjj.com
fbdjj.com
fbdjj
9
https:// www. fbdjj.com
com
fbdjj.com
826
fz-222.com
fz-222.com
fz-222
10
https:// www. fz-222.com
com
fz-222.com
827
fourloughcheesecake.com
fourloughcheesecake.com
fourloughcheesecake
23
https:// www. fourloughcheesecake.com
com
fourloughcheesecake.com
828
fwykw.com
fwykw.com
fwykw
9
https:// www. fwykw.com
com
fwykw.com
829
fingerscadburysfc.com
fingerscadburysfc.com
fingerscadburysfc
21
https:// www. fingerscadburysfc.com
com
fingerscadburysfc.com
830
foodvanman.com
foodvanman.com
foodvanman
14
https:// www. foodvanman.com
com
foodvanman.com
831
fdjhghjhdf.com
fdjhghjhdf.com
fdjhghjhdf
14
https:// www. fdjhghjhdf.com
com
fdjhghjhdf.com
832
fragrentjewles.com
fragrentjewles.com
fragrentjewles
18
https:// www. fragrentjewles.com
com
fragrentjewles.com
833
fabnotfat.com
fabnotfat.com
fabnotfat
13
https:// www. fabnotfat.com
com
fabnotfat.com
834
flyyuyan.com
flyyuyan.com
flyyuyan
12
https:// www. flyyuyan.com
com
flyyuyan.com
835
footbodyguard.com
footbodyguard.com
footbodyguard
17
https:// www. footbodyguard.com
com
footbodyguard.com
836
fbcreator.com
fbcreator.com
fbcreator
13
https:// www. fbcreator.com
com
fbcreator.com
837
fqdxz.com
fqdxz.com
fqdxz
9
https:// www. fqdxz.com
com
fqdxz.com
838
fiosvw.com
fiosvw.com
fiosvw
10
https:// www. fiosvw.com
com
fiosvw.com
839
flightexpertsales.com
flightexpertsales.com
flightexpertsales
21
https:// www. flightexpertsales.com
com
flightexpertsales.com
840
foot-stuff.com
foot-stuff.com
foot-stuff
14
https:// www. foot-stuff.com
com
foot-stuff.com
841
findyouraloha.com
findyouraloha.com
findyouraloha
17
https:// www. findyouraloha.com
com
findyouraloha.com
842
florencejosh.com
florencejosh.com
florencejosh
16
https:// www. florencejosh.com
com
florencejosh.com
843
feetassist.com
feetassist.com
feetassist
14
https:// www. feetassist.com
com
feetassist.com
844
fitvulva.com
fitvulva.com
fitvulva
12
https:// www. fitvulva.com
com
fitvulva.com
845
fabjt.com
fabjt.com
fabjt
9
https:// www. fabjt.com
com
fabjt.com
846
fienon.com
fienon.com
fienon
10
https:// www. fienon.com
com
fienon.com
847
ferramentaskenedy.com
ferramentaskenedy.com
ferramentaskenedy
21
https:// www. ferramentaskenedy.com
com
ferramentaskenedy.com
848
floatingfolks.com
floatingfolks.com
floatingfolks
17
https:// www. floatingfolks.com
com
floatingfolks.com
849
fillbars.com
fillbars.com
fillbars
12
https:// www. fillbars.com
com
fillbars.com
850
fabfw.com
fabfw.com
fabfw
9
https:// www. fabfw.com
com
fabfw.com
851
fun-teng.com
fun-teng.com
fun-teng
12
https:// www. fun-teng.com
com
fun-teng.com
852
full-cc.com
full-cc.com
full-cc
11
https:// www. full-cc.com
com
full-cc.com
853
fredeticksburg.com
fredeticksburg.com
fredeticksburg
18
https:// www. fredeticksburg.com
com
fredeticksburg.com
854
fongleng.com
fongleng.com
fongleng
12
https:// www. fongleng.com
com
fongleng.com
855
fireweedfloral.com
fireweedfloral.com
fireweedfloral
18
https:// www. fireweedfloral.com
com
fireweedfloral.com
856
fifty6marketing.com
fifty6marketing.com
fifty6marketing
19
https:// www. fifty6marketing.com
com
fifty6marketing.com
857
fredericskburgrestaurantweek.com
fredericskburgrestaurantweek.com
fredericskburgrestaurantweek
32
https:// www. fredericskburgrestaurantweek.com
com
fredericskburgrestaurantweek.com
858
futurefreestyle.com
futurefreestyle.com
futurefreestyle
19
https:// www. futurefreestyle.com
com
futurefreestyle.com
859
fillplays.com
fillplays.com
fillplays
13
https:// www. fillplays.com
com
fillplays.com
860
fhacreditrequirements.com
fhacreditrequirements.com
fhacreditrequirements
25
https:// www. fhacreditrequirements.com
com
fhacreditrequirements.com
861
forgemontana.com
forgemontana.com
forgemontana
16
https:// www. forgemontana.com
com
forgemontana.com
862
floyd-education.com
floyd-education.com
floyd-education
19
https:// www. floyd-education.com
com
floyd-education.com
863
fitness-w.com
fitness-w.com
fitness-w
13
https:// www. fitness-w.com
com
fitness-w.com
864
fourchee.com
fourchee.com
fourchee
12
https:// www. fourchee.com
com
fourchee.com
865
forevergasque.com
forevergasque.com
forevergasque
17
https:// www. forevergasque.com
com
forevergasque.com
866
finishyourgreens.com
finishyourgreens.com
finishyourgreens
20
https:// www. finishyourgreens.com
com
finishyourgreens.com
867
ferraraforcongress.com
ferraraforcongress.com
ferraraforcongress
22
https:// www. ferraraforcongress.com
com
ferraraforcongress.com
868
fourdublin.com
fourdublin.com
fourdublin
14
https:// www. fourdublin.com
com
fourdublin.com
869
farmsforum.com
farmsforum.com
farmsforum
14
https:// www. farmsforum.com
com
farmsforum.com
870
flippped.com
flippped.com
flippped
12
https:// www. flippped.com
com
flippped.com
871
fairishgroove.com
fairishgroove.com
fairishgroove
17
https:// www. fairishgroove.com
com
fairishgroove.com
872
fullcircledivorceassistance.com
fullcircledivorceassistance.com
fullcircledivorceassistance
31
https:// www. fullcircledivorceassistance.com
com
fullcircledivorceassistance.com
873
funnyx10.com
funnyx10.com
funnyx10
12
https:// www. funnyx10.com
com
funnyx10.com
874
fruitvegetablesupplements.com
fruitvegetablesupplements.com
fruitvegetablesupplements
29
https:// www. fruitvegetablesupplements.com
com
fruitvegetablesupplements.com
875
funnelsapp.com
funnelsapp.com
funnelsapp
14
https:// www. funnelsapp.com
com
funnelsapp.com
876
factassist.com
factassist.com
factassist
14
https:// www. factassist.com
com
factassist.com
877
fizzedrocks.com
fizzedrocks.com
fizzedrocks
15
https:// www. fizzedrocks.com
com
fizzedrocks.com
878
farmshaker.com
farmshaker.com
farmshaker
14
https:// www. farmshaker.com
com
farmshaker.com
879
frenchriviera-bijoux.com
frenchriviera-bijoux.com
frenchriviera-bijoux
24
https:// www. frenchriviera-bijoux.com
com
frenchriviera-bijoux.com
880
fireupusa.com
fireupusa.com
fireupusa
13
https:// www. fireupusa.com
com
fireupusa.com
881
flck3.com
flck3.com
flck3
9
https:// www. flck3.com
com
flck3.com
882
fmoviescab.com
fmoviescab.com
fmoviescab
14
https:// www. fmoviescab.com
com
fmoviescab.com
883
fishinghuntinghshow.com
fishinghuntinghshow.com
fishinghuntinghshow
23
https:// www. fishinghuntinghshow.com
com
fishinghuntinghshow.com
884
florrieandboo.com
florrieandboo.com
florrieandboo
17
https:// www. florrieandboo.com
com
florrieandboo.com
885
fingsavage.com
fingsavage.com
fingsavage
14
https:// www. fingsavage.com
com
fingsavage.com
886
forbiddencherry.com
forbiddencherry.com
forbiddencherry
19
https:// www. forbiddencherry.com
com
forbiddencherry.com
887
fivetofeelalive.com
fivetofeelalive.com
fivetofeelalive
19
https:// www. fivetofeelalive.com
com
fivetofeelalive.com
888
freehostingtrust.com
freehostingtrust.com
freehostingtrust
20
https:// www. freehostingtrust.com
com
freehostingtrust.com
889
foxfigitalmovies.com
foxfigitalmovies.com
foxfigitalmovies
20
https:// www. foxfigitalmovies.com
com
foxfigitalmovies.com
890
fittoflush.com
fittoflush.com
fittoflush
14
https:// www. fittoflush.com
com
fittoflush.com
891
fqsina.com
fqsina.com
fqsina
10
https:// www. fqsina.com
com
fqsina.com
892
fletesmar.com
fletesmar.com
fletesmar
13
https:// www. fletesmar.com
com
fletesmar.com
893
foodisnotafight.com
foodisnotafight.com
foodisnotafight
19
https:// www. foodisnotafight.com
com
foodisnotafight.com
894
fi2mi.com
fi2mi.com
fi2mi
9
https:// www. fi2mi.com
com
fi2mi.com
895
foglebags.com
foglebags.com
foglebags
13
https:// www. foglebags.com
com
foglebags.com
896
fqbsc.com
fqbsc.com
fqbsc
9
https:// www. fqbsc.com
com
fqbsc.com
897
franescadesimone.com
franescadesimone.com
franescadesimone
20
https:// www. franescadesimone.com
com
franescadesimone.com
898
fakenewspersonalityroftheyear.com
fakenewspersonalityroftheyear.com
fakenewspersonalityroftheyear
33
https:// www. fakenewspersonalityroftheyear.com
com
fakenewspersonalityroftheyear.com
899
fyiinvestigator.com
fyiinvestigator.com
fyiinvestigator
19
https:// www. fyiinvestigator.com
com
fyiinvestigator.com
900
falconpreview.com
falconpreview.com
falconpreview
17
https:// www. falconpreview.com
com
falconpreview.com
901
funsunglass.com
funsunglass.com
funsunglass
15
https:// www. funsunglass.com
com
funsunglass.com
902
funnysauce.com
funnysauce.com
funnysauce
14
https:// www. funnysauce.com
com
funnysauce.com
903
fortinetperu.com
fortinetperu.com
fortinetperu
16
https:// www. fortinetperu.com
com
fortinetperu.com
904
fastestpony.com
fastestpony.com
fastestpony
15
https:// www. fastestpony.com
com
fastestpony.com
905
fxorange.com
fxorange.com
fxorange
12
https:// www. fxorange.com
com
fxorange.com
906
fachschaft24.com
fachschaft24.com
fachschaft24
16
https:// www. fachschaft24.com
com
fachschaft24.com
907
fastfitpt.com
fastfitpt.com
fastfitpt
13
https:// www. fastfitpt.com
com
fastfitpt.com
908
ffglobetrotter.com
ffglobetrotter.com
ffglobetrotter
18
https:// www. ffglobetrotter.com
com
ffglobetrotter.com
909
freelikers.com
freelikers.com
freelikers
14
https:// www. freelikers.com
com
freelikers.com
910
fakrfak.com
fakrfak.com
fakrfak
11
https:// www. fakrfak.com
com
fakrfak.com
911
flosight.com
flosight.com
flosight
12
https:// www. flosight.com
com
flosight.com
912
fzgljd.com
fzgljd.com
fzgljd
10
https:// www. fzgljd.com
com
fzgljd.com
913
frontierspinining.com
frontierspinining.com
frontierspinining
21
https:// www. frontierspinining.com
com
frontierspinining.com
914
funakura-seikotsu.com
funakura-seikotsu.com
funakura-seikotsu
21
https:// www. funakura-seikotsu.com
com
funakura-seikotsu.com
915
fishinggreatlakes.com
fishinggreatlakes.com
fishinggreatlakes
21
https:// www. fishinggreatlakes.com
com
fishinggreatlakes.com
916
fitnessmoneyclub.com
fitnessmoneyclub.com
fitnessmoneyclub
20
https:// www. fitnessmoneyclub.com
com
fitnessmoneyclub.com
917
fllowze.com
fllowze.com
fllowze
11
https:// www. fllowze.com
com
fllowze.com
918
f7a5lv.com
f7a5lv.com
f7a5lv
10
https:// www. f7a5lv.com
com
f7a5lv.com
919
fanaparis.com
fanaparis.com
fanaparis
13
https:// www. fanaparis.com
com
fanaparis.com
920
following-garyvee.com
following-garyvee.com
following-garyvee
21
https:// www. following-garyvee.com
com
following-garyvee.com
921
flsmd.com
flsmd.com
flsmd
9
https:// www. flsmd.com
com
flsmd.com
922
filtersvacuum.com
filtersvacuum.com
filtersvacuum
17
https:// www. filtersvacuum.com
com
filtersvacuum.com
923
feitong2008.com
feitong2008.com
feitong2008
15
https:// www. feitong2008.com
com
feitong2008.com
924
fredbergerdesignandbuild.com
fredbergerdesignandbuild.com
fredbergerdesignandbuild
28
https:// www. fredbergerdesignandbuild.com
com
fredbergerdesignandbuild.com
925
fujakurniawan.com
fujakurniawan.com
fujakurniawan
17
https:// www. fujakurniawan.com
com
fujakurniawan.com
926
fourthopitality.com
fourthopitality.com
fourthopitality
19
https:// www. fourthopitality.com
com
fourthopitality.com
927
fubicai.com
fubicai.com
fubicai
11
https:// www. fubicai.com
com
fubicai.com
928
fordelegate.com
fordelegate.com
fordelegate
15
https:// www. fordelegate.com
com
fordelegate.com
929
freetimevalue.com
freetimevalue.com
freetimevalue
17
https:// www. freetimevalue.com
com
freetimevalue.com
930
fitolity.com
fitolity.com
fitolity
12
https:// www. fitolity.com
com
fitolity.com
931
flightcentrebuyback.com
flightcentrebuyback.com
flightcentrebuyback
23
https:// www. flightcentrebuyback.com
com
flightcentrebuyback.com
932
fit-ergysport.com
fit-ergysport.com
fit-ergysport
17
https:// www. fit-ergysport.com
com
fit-ergysport.com
933
forexorpro.com
forexorpro.com
forexorpro
14
https:// www. forexorpro.com
com
forexorpro.com
934
foodinspirasi.com
foodinspirasi.com
foodinspirasi
17
https:// www. foodinspirasi.com
com
foodinspirasi.com
935
fdacs-cannabis.com
fdacs-cannabis.com
fdacs-cannabis
18
https:// www. fdacs-cannabis.com
com
fdacs-cannabis.com
936
freescrapmetalcollectionwestmidlands.com
freescrapmetalcollectionwestmidlands.com
freescrapmetalcollectionwestmidlands
40
https:// www. freescrapmetalcollectionwestmidlands.com
com
freescrapmetalcollectionwestmidlands.com
937
fqcl666.com
fqcl666.com
fqcl666
11
https:// www. fqcl666.com
com
fqcl666.com
938
family-bestgifts.com
family-bestgifts.com
family-bestgifts
20
https:// www. family-bestgifts.com
com
family-bestgifts.com
939
fangrongid.com
fangrongid.com
fangrongid
14
https:// www. fangrongid.com
com
fangrongid.com
940
freestylesinging.com
freestylesinging.com
freestylesinging
20
https:// www. freestylesinging.com
com
freestylesinging.com
941
fabriciovillarreal.com
fabriciovillarreal.com
fabriciovillarreal
22
https:// www. fabriciovillarreal.com
com
fabriciovillarreal.com
942
fitdoula.com
fitdoula.com
fitdoula
12
https:// www. fitdoula.com
com
fitdoula.com
943
faccuweather.com
faccuweather.com
faccuweather
16
https:// www. faccuweather.com
com
faccuweather.com
944
f60wy.com
f60wy.com
f60wy
9
https:// www. f60wy.com
com
f60wy.com
945
flugel-photobooks.com
flugel-photobooks.com
flugel-photobooks
21
https:// www. flugel-photobooks.com
com
flugel-photobooks.com
946
fatecore.com
fatecore.com
fatecore
12
https:// www. fatecore.com
com
fatecore.com
947
fugeit.com
fugeit.com
fugeit
10
https:// www. fugeit.com
com
fugeit.com
948
fuzhouxww123.com
fuzhouxww123.com
fuzhouxww123
16
https:// www. fuzhouxww123.com
com
fuzhouxww123.com
949
flotyn.com
flotyn.com
flotyn
10
https:// www. flotyn.com
com
flotyn.com
950
fz-111.com
fz-111.com
fz-111
10
https:// www. fz-111.com
com
fz-111.com
951
fbchillsville.com
fbchillsville.com
fbchillsville
17
https:// www. fbchillsville.com
com
fbchillsville.com
952
finachic.com
finachic.com
finachic
12
https:// www. finachic.com
com
finachic.com
953
foamkoozies.com
foamkoozies.com
foamkoozies
15
https:// www. foamkoozies.com
com
foamkoozies.com
954
funbookmarking.com
funbookmarking.com
funbookmarking
18
https:// www. funbookmarking.com
com
funbookmarking.com
955
fruitshades.com
fruitshades.com
fruitshades
15
https:// www. fruitshades.com
com
fruitshades.com
956
fillrealestate.com
fillrealestate.com
fillrealestate
18
https:// www. fillrealestate.com
com
fillrealestate.com
957
freeanswerguide.com
freeanswerguide.com
freeanswerguide
19
https:// www. freeanswerguide.com
com
freeanswerguide.com
958
freshofftheboatvintage.com
freshofftheboatvintage.com
freshofftheboatvintage
26
https:// www. freshofftheboatvintage.com
com
freshofftheboatvintage.com
959
fitrat.com
fitrat.com
fitrat
10
https:// www. fitrat.com
com
fitrat.com
960
fatimaesanchez.com
fatimaesanchez.com
fatimaesanchez
18
https:// www. fatimaesanchez.com
com
fatimaesanchez.com
961
feontgate.com
feontgate.com
feontgate
13
https:// www. feontgate.com
com
feontgate.com
962
fieldstein.com
fieldstein.com
fieldstein
14
https:// www. fieldstein.com
com
fieldstein.com
963
fjpj559w3wuz6.com
fjpj559w3wuz6.com
fjpj559w3wuz6
17
https:// www. fjpj559w3wuz6.com
com
fjpj559w3wuz6.com
964
fun-life-info.com
fun-life-info.com
fun-life-info
17
https:// www. fun-life-info.com
com
fun-life-info.com
965
fashionuni***.com
fashionuni***.com
fashionunisex
17
https:// www. fashionuni***.com
com
fashionunisex.com
966
faithembracesfear.com
faithembracesfear.com
faithembracesfear
21
https:// www. faithembracesfear.com
com
faithembracesfear.com
967
femdecs.com
femdecs.com
femdecs
11
https:// www. femdecs.com
com
femdecs.com
968
farnivest.com
farnivest.com
farnivest
13
https:// www. farnivest.com
com
farnivest.com
969
frecciasport.com
frecciasport.com
frecciasport
16
https:// www. frecciasport.com
com
frecciasport.com
970
filtervacuum.com
filtervacuum.com
filtervacuum
16
https:// www. filtervacuum.com
com
filtervacuum.com
971
fight-society.com
fight-society.com
fight-society
17
https:// www. fight-society.com
com
fight-society.com
972
figuredeals.com
figuredeals.com
figuredeals
15
https:// www. figuredeals.com
com
figuredeals.com
973
face2table.com
face2table.com
face2table
14
https:// www. face2table.com
com
face2table.com
974
fozziesfuzzies.com
fozziesfuzzies.com
fozziesfuzzies
18
https:// www. fozziesfuzzies.com
com
fozziesfuzzies.com
975
fujiahealth.com
fujiahealth.com
fujiahealth
15
https:// www. fujiahealth.com
com
fujiahealth.com
976
familydq.com
familydq.com
familydq
12
https:// www. familydq.com
com
familydq.com
977
fithappyherbivore.com
fithappyherbivore.com
fithappyherbivore
21
https:// www. fithappyherbivore.com
com
fithappyherbivore.com
978
firsttothekey.com
firsttothekey.com
firsttothekey
17
https:// www. firsttothekey.com
com
firsttothekey.com
979
fkldf.com
fkldf.com
fkldf
9
https:// www. fkldf.com
com
fkldf.com
980
funtastespain.com
funtastespain.com
funtastespain
17
https:// www. funtastespain.com
com
funtastespain.com
981
faststartcareers.com
faststartcareers.com
faststartcareers
20
https:// www. faststartcareers.com
com
faststartcareers.com
982
filthyrichhairclub.com
filthyrichhairclub.com
filthyrichhairclub
22
https:// www. filthyrichhairclub.com
com
filthyrichhairclub.com
983
funnyrc.com
funnyrc.com
funnyrc
11
https:// www. funnyrc.com
com
funnyrc.com
984
flcashbuy.com
flcashbuy.com
flcashbuy
13
https:// www. flcashbuy.com
com
flcashbuy.com
985
freegamesunity.com
freegamesunity.com
freegamesunity
18
https:// www. freegamesunity.com
com
freegamesunity.com
986
famousvibes.com
famousvibes.com
famousvibes
15
https:// www. famousvibes.com
com
famousvibes.com
987
francishascheaphomes.com
francishascheaphomes.com
francishascheaphomes
24
https:// www. francishascheaphomes.com
com
francishascheaphomes.com
988
fa079.com
fa079.com
fa079
9
https:// www. fa079.com
com
fa079.com
989
finishlinestrategies.com
finishlinestrategies.com
finishlinestrategies
24
https:// www. finishlinestrategies.com
com
finishlinestrategies.com
990
famoussteaksushi.com
famoussteaksushi.com
famoussteaksushi
20
https:// www. famoussteaksushi.com
com
famoussteaksushi.com
991
firsttouchsd.com
firsttouchsd.com
firsttouchsd
16
https:// www. firsttouchsd.com
com
firsttouchsd.com
992
flormons.com
flormons.com
flormons
12
https:// www. flormons.com
com
flormons.com
993
fillcamp.com
fillcamp.com
fillcamp
12
https:// www. fillcamp.com
com
fillcamp.com
994
fllory.com
fllory.com
fllory
10
https:// www. fllory.com
com
fllory.com
995
fjqiaodong.com
fjqiaodong.com
fjqiaodong
14
https:// www. fjqiaodong.com
com
fjqiaodong.com
996
frenchbulldog-sanfrancisco.com
frenchbulldog-sanfrancisco.com
frenchbulldog-sanfrancisco
30
https:// www. frenchbulldog-sanfrancisco.com
com
frenchbulldog-sanfrancisco.com
997
foxfinecarpentry.com
foxfinecarpentry.com
foxfinecarpentry
20
https:// www. foxfinecarpentry.com
com
foxfinecarpentry.com
998
financialservicesmarketingsimplified.com
financialservicesmarketingsimplified.com
financialservicesmarketingsimplified
40
https:// www. financialservicesmarketingsimplified.com
com
financialservicesmarketingsimplified.com
999
fensemao.com
fensemao.com
fensemao
12
https:// www. fensemao.com
com
fensemao.com
1,000
fourmea.com
fourmea.com
fourmea
11
https:// www. fourmea.com
com
fourmea.com

Previous page (1) | Current page (2) | Next page (3) | All Pages

Last 100 days domain names registered

  1. Wed, 17 Apr, 2019
  2. Tue, 16 Apr, 2019
  3. Mon, 15 Apr, 2019
  4. Sun, 14 Apr, 2019
  5. Sat, 13 Apr, 2019
  6. Fri, 12 Apr, 2019
  7. Thu, 11 Apr, 2019
  8. Wed, 10 Apr, 2019
  9. Tue, 9 Apr, 2019
  10. Mon, 8 Apr, 2019
  11. Sun, 7 Apr, 2019
  12. Sat, 6 Apr, 2019
  13. Fri, 5 Apr, 2019
  14. Thu, 4 Apr, 2019
  15. Wed, 3 Apr, 2019
  16. Tue, 2 Apr, 2019
  17. Mon, 1 Apr, 2019
  18. Sun, 31 Mar, 2019
  19. Sat, 30 Mar, 2019
  20. Fri, 29 Mar, 2019
  21. Thu, 28 Mar, 2019
  22. Wed, 27 Mar, 2019
  23. Tue, 26 Mar, 2019
  24. Mon, 25 Mar, 2019
  25. Sun, 24 Mar, 2019
  26. Sat, 23 Mar, 2019
  27. Fri, 22 Mar, 2019
  28. Thu, 21 Mar, 2019
  29. Wed, 20 Mar, 2019
  30. Tue, 19 Mar, 2019
  31. Mon, 18 Mar, 2019
  32. Sun, 17 Mar, 2019
  33. Sat, 16 Mar, 2019
  34. Fri, 15 Mar, 2019
  35. Thu, 14 Mar, 2019
  36. Wed, 13 Mar, 2019
  37. Tue, 12 Mar, 2019
  38. Mon, 11 Mar, 2019
  39. Sun, 10 Mar, 2019
  40. Sat, 9 Mar, 2019
  41. Fri, 8 Mar, 2019
  42. Thu, 7 Mar, 2019
  43. Wed, 6 Mar, 2019
  44. Tue, 5 Mar, 2019
  45. Mon, 4 Mar, 2019
  46. Sun, 3 Mar, 2019
  47. Sat, 2 Mar, 2019
  48. Fri, 1 Mar, 2019
  49. Thu, 28 Feb, 2019
  50. Wed, 27 Feb, 2019
  51. Tue, 26 Feb, 2019
  52. Mon, 25 Feb, 2019
  53. Sun, 24 Feb, 2019
  54. Sat, 23 Feb, 2019
  55. Fri, 22 Feb, 2019
  56. Thu, 21 Feb, 2019
  57. Wed, 20 Feb, 2019
  58. Tue, 19 Feb, 2019
  59. Mon, 18 Feb, 2019
  60. Sun, 17 Feb, 2019
  61. Sat, 16 Feb, 2019
  62. Fri, 15 Feb, 2019
  63. Thu, 14 Feb, 2019
  64. Wed, 13 Feb, 2019
  65. Tue, 12 Feb, 2019
  66. Mon, 11 Feb, 2019
  67. Sun, 10 Feb, 2019
  68. Sat, 9 Feb, 2019
  69. Fri, 8 Feb, 2019
  70. Thu, 7 Feb, 2019
  71. Wed, 6 Feb, 2019
  72. Tue, 5 Feb, 2019
  73. Mon, 4 Feb, 2019
  74. Sun, 3 Feb, 2019
  75. Sat, 2 Feb, 2019
  76. Fri, 1 Feb, 2019
  77. Thu, 31 Jan, 2019
  78. Wed, 30 Jan, 2019
  79. Tue, 29 Jan, 2019
  80. Mon, 28 Jan, 2019
  81. Sun, 27 Jan, 2019
  82. Sat, 26 Jan, 2019
  83. Fri, 25 Jan, 2019
  84. Thu, 24 Jan, 2019
  85. Wed, 23 Jan, 2019
  86. Tue, 22 Jan, 2019
  87. Mon, 21 Jan, 2019
  88. Sun, 20 Jan, 2019
  89. Sat, 19 Jan, 2019
  90. Fri, 18 Jan, 2019
  91. Thu, 17 Jan, 2019
  92. Wed, 16 Jan, 2019
  93. Tue, 15 Jan, 2019
  94. Mon, 14 Jan, 2019
  95. Sun, 13 Jan, 2019
  96. Sat, 12 Jan, 2019
  97. Fri, 11 Jan, 2019
  98. Thu, 10 Jan, 2019
  99. Wed, 9 Jan, 2019
  100. Tue, 8 Jan, 2019

Homepage | Privacy Policy

Our sites: Download Apps | Song Lyrics | Submit Articles

Copyright © 2019 Domain Name Registered . All rights reserved.
Cached: IP: 3.90.56.90, 21 April, 2019 11:18:26 (LONDON - UK).

Domain-Name-Registered.Com

All about Domain Name, Domain Tools and Domain Name Database

Free Whois Tool

Check the domain name owner, when it first registration, expire..

Free Domain Checker

Check domain available or not, then can buy or renew or back order

Webpage Header Checker

Free check Webpage Header return thats hidden from users

Daily Domain Name Registration

Free tool to check domain name first registered by day