Domain-Name-Registered.Com

Domain Name Registered on Tuesday Mar 05, 2019 page 1.

There are hundreds of thousands of domains were registered daily, and this place DOMAIN-NAME-REGISTERED.COM is where you can check out almost domains are registered by day. Our domain database is to update list of domains by day, registrar, and extension. Lists contain daily changes (yes, some registrars do register 100k+ domains!). .

Where does this data come from?

All of our data comes from analyzing publicly accessible database from domain registrars. Due to registry restrictions we are only able to download the zones once per day (hence the 48 delay in processing).

#
Domain Name
Main Domain
www
https
Length
Ext
Whois
1
fishkeepingworldmag.com
fishkeepingworldmag.com
fishkeepingworldmag
23
https:// www. fishkeepingworldmag.com
com
fishkeepingworldmag.com
2
fbzjzrr.com
fbzjzrr.com
fbzjzrr
11
https:// www. fbzjzrr.com
com
fbzjzrr.com
3
fizbizblog.com
fizbizblog.com
fizbizblog
14
https:// www. fizbizblog.com
com
fizbizblog.com
4
florabelleindia.com
florabelleindia.com
florabelleindia
19
https:// www. florabelleindia.com
com
florabelleindia.com
5
fg8883.com
fg8883.com
fg8883
10
https:// www. fg8883.com
com
fg8883.com
6
fdpbt.com
fdpbt.com
fdpbt
9
https:// www. fdpbt.com
com
fdpbt.com
7
f69szd.com
f69szd.com
f69szd
10
https:// www. f69szd.com
com
f69szd.com
8
fred-frida.com
fred-frida.com
fred-frida
14
https:// www. fred-frida.com
com
fred-frida.com
9
fibromyalgialosangeles.com
fibromyalgialosangeles.com
fibromyalgialosangeles
26
https:// www. fibromyalgialosangeles.com
com
fibromyalgialosangeles.com
10
fashiongrin.com
fashiongrin.com
fashiongrin
15
https:// www. fashiongrin.com
com
fashiongrin.com
11
ffy22.com
ffy22.com
ffy22
9
https:// www. ffy22.com
com
ffy22.com
12
fitforlifeptstudio.com
fitforlifeptstudio.com
fitforlifeptstudio
22
https:// www. fitforlifeptstudio.com
com
fitforlifeptstudio.com
13
fieldandrowe.com
fieldandrowe.com
fieldandrowe
16
https:// www. fieldandrowe.com
com
fieldandrowe.com
14
fashion-asylum.com
fashion-asylum.com
fashion-asylum
18
https:// www. fashion-asylum.com
com
fashion-asylum.com
15
fagree.com
fagree.com
fagree
10
https:// www. fagree.com
com
fagree.com
16
fnq68.com
fnq68.com
fnq68
9
https:// www. fnq68.com
com
fnq68.com
17
flavorbrisk.com
flavorbrisk.com
flavorbrisk
15
https:// www. flavorbrisk.com
com
flavorbrisk.com
18
faucon-transit.com
faucon-transit.com
faucon-transit
18
https:// www. faucon-transit.com
com
faucon-transit.com
19
f6djiawz-e8at.com
f6djiawz-e8at.com
f6djiawz-e8at
17
https:// www. f6djiawz-e8at.com
com
f6djiawz-e8at.com
20
fantasysportsrefund.com
fantasysportsrefund.com
fantasysportsrefund
23
https:// www. fantasysportsrefund.com
com
fantasysportsrefund.com
21
foodrollercoaster.com
foodrollercoaster.com
foodrollercoaster
21
https:// www. foodrollercoaster.com
com
foodrollercoaster.com
22
ffy33.com
ffy33.com
ffy33
9
https:// www. ffy33.com
com
ffy33.com
23
fdphy.com
fdphy.com
fdphy
9
https:// www. fdphy.com
com
fdphy.com
24
fierceexcursions.com
fierceexcursions.com
fierceexcursions
20
https:// www. fierceexcursions.com
com
fierceexcursions.com
25
faceofmomo.com
faceofmomo.com
faceofmomo
14
https:// www. faceofmomo.com
com
faceofmomo.com
26
floridaorlandocbdoil.com
floridaorlandocbdoil.com
floridaorlandocbdoil
24
https:// www. floridaorlandocbdoil.com
com
floridaorlandocbdoil.com
27
faithinchristianity.com
faithinchristianity.com
faithinchristianity
23
https:// www. faithinchristianity.com
com
faithinchristianity.com
28
foodiotv.com
foodiotv.com
foodiotv
12
https:// www. foodiotv.com
com
foodiotv.com
29
f22motorsport.com
f22motorsport.com
f22motorsport
17
https:// www. f22motorsport.com
com
f22motorsport.com
30
fifa55tip.com
fifa55tip.com
fifa55tip
13
https:// www. fifa55tip.com
com
fifa55tip.com
31
fantasticoffers101.com
fantasticoffers101.com
fantasticoffers101
22
https:// www. fantasticoffers101.com
com
fantasticoffers101.com
32
facette-dentaire-mulhouse.com
facette-dentaire-mulhouse.com
facette-dentaire-mulhouse
29
https:// www. facette-dentaire-mulhouse.com
com
facette-dentaire-mulhouse.com
33
fmcgtr.com
fmcgtr.com
fmcgtr
10
https:// www. fmcgtr.com
com
fmcgtr.com
34
fannyzmt.com
fannyzmt.com
fannyzmt
12
https:// www. fannyzmt.com
com
fannyzmt.com
35
fnbholcomb.com
fnbholcomb.com
fnbholcomb
14
https:// www. fnbholcomb.com
com
fnbholcomb.com
36
faculdadeinnap.com
faculdadeinnap.com
faculdadeinnap
18
https:// www. faculdadeinnap.com
com
faculdadeinnap.com
37
family-drugstore.com
family-drugstore.com
family-drugstore
20
https:// www. family-drugstore.com
com
family-drugstore.com
38
fourcornersinnovation.com
fourcornersinnovation.com
fourcornersinnovation
25
https:// www. fourcornersinnovation.com
com
fourcornersinnovation.com
39
fentiandwallace.com
fentiandwallace.com
fentiandwallace
19
https:// www. fentiandwallace.com
com
fentiandwallace.com
40
fartingart.com
fartingart.com
fartingart
14
https:// www. fartingart.com
com
fartingart.com
41
ff6161.com
ff6161.com
ff6161
10
https:// www. ff6161.com
com
ff6161.com
42
fangyuanyeya.com
fangyuanyeya.com
fangyuanyeya
16
https:// www. fangyuanyeya.com
com
fangyuanyeya.com
43
fajartechnologies.com
fajartechnologies.com
fajartechnologies
21
https:// www. fajartechnologies.com
com
fajartechnologies.com
44
familylawhighhetworthspecialist.com
familylawhighhetworthspecialist.com
familylawhighhetworthspecialist
35
https:// www. familylawhighhetworthspecialist.com
com
familylawhighhetworthspecialist.com
45
flexibleresumes.com
flexibleresumes.com
flexibleresumes
19
https:// www. flexibleresumes.com
com
flexibleresumes.com
46
fetish-lady-ann.com
fetish-lady-ann.com
fetish-lady-ann
19
https:// www. fetish-lady-ann.com
com
fetish-lady-ann.com
47
fedexeurope2019.com
fedexeurope2019.com
fedexeurope2019
19
https:// www. fedexeurope2019.com
com
fedexeurope2019.com
48
flatuimaps.com
flatuimaps.com
flatuimaps
14
https:// www. flatuimaps.com
com
flatuimaps.com
49
fh6689.com
fh6689.com
fh6689
10
https:// www. fh6689.com
com
fh6689.com
50
fergaranblog.com
fergaranblog.com
fergaranblog
16
https:// www. fergaranblog.com
com
fergaranblog.com
51
finalvip.com
finalvip.com
finalvip
12
https:// www. finalvip.com
com
finalvip.com
52
finalat-core.com
finalat-core.com
finalat-core
16
https:// www. finalat-core.com
com
finalat-core.com
53
forcompressor.com
forcompressor.com
forcompressor
17
https:// www. forcompressor.com
com
forcompressor.com
54
factoryinjohor.com
factoryinjohor.com
factoryinjohor
18
https:// www. factoryinjohor.com
com
factoryinjohor.com
55
fevuto.com
fevuto.com
fevuto
10
https:// www. fevuto.com
com
fevuto.com
56
freakmommedia.com
freakmommedia.com
freakmommedia
17
https:// www. freakmommedia.com
com
freakmommedia.com
57
filiatentena.com
filiatentena.com
filiatentena
16
https:// www. filiatentena.com
com
filiatentena.com
58
ferecoupon.com
ferecoupon.com
ferecoupon
14
https:// www. ferecoupon.com
com
ferecoupon.com
59
feriran.com
feriran.com
feriran
11
https:// www. feriran.com
com
feriran.com
60
fideliscbd.com
fideliscbd.com
fideliscbd
14
https:// www. fideliscbd.com
com
fideliscbd.com
61
firstgulfretail.com
firstgulfretail.com
firstgulfretail
19
https:// www. firstgulfretail.com
com
firstgulfretail.com
62
fernoceanproject.com
fernoceanproject.com
fernoceanproject
20
https:// www. fernoceanproject.com
com
fernoceanproject.com
63
freexbux.com
freexbux.com
freexbux
12
https:// www. freexbux.com
com
freexbux.com
64
fedore2019.com
fedore2019.com
fedore2019
14
https:// www. fedore2019.com
com
fedore2019.com
65
farehatbor.com
farehatbor.com
farehatbor
14
https:// www. farehatbor.com
com
farehatbor.com
66
fandaho.com
fandaho.com
fandaho
11
https:// www. fandaho.com
com
fandaho.com
67
forbofe.com
forbofe.com
forbofe
11
https:// www. forbofe.com
com
forbofe.com
68
fawan010.com
fawan010.com
fawan010
12
https:// www. fawan010.com
com
fawan010.com
69
firstfloorboutique.com
firstfloorboutique.com
firstfloorboutique
22
https:// www. firstfloorboutique.com
com
firstfloorboutique.com
70
florabellaindia.com
florabellaindia.com
florabellaindia
19
https:// www. florabellaindia.com
com
florabellaindia.com
71
fdesk-ppconfirm.com
fdesk-ppconfirm.com
fdesk-ppconfirm
19
https:// www. fdesk-ppconfirm.com
com
fdesk-ppconfirm.com
72
farid-scott-lahlou.com
farid-scott-lahlou.com
farid-scott-lahlou
22
https:// www. farid-scott-lahlou.com
com
farid-scott-lahlou.com
73
fosseeb.com
fosseeb.com
fosseeb
11
https:// www. fosseeb.com
com
fosseeb.com
74
faguoouruiqingshuangluzp315.com
faguoouruiqingshuangluzp315.com
faguoouruiqingshuangluzp315
31
https:// www. faguoouruiqingshuangluzp315.com
com
faguoouruiqingshuangluzp315.com
75
fifashooter.com
fifashooter.com
fifashooter
15
https:// www. fifashooter.com
com
fifashooter.com
76
fzsszs.com
fzsszs.com
fzsszs
10
https:// www. fzsszs.com
com
fzsszs.com
77
fqzgc.com
fqzgc.com
fqzgc
9
https:// www. fqzgc.com
com
fqzgc.com
78
f6x4yibn-p7g4.com
f6x4yibn-p7g4.com
f6x4yibn-p7g4
17
https:// www. f6x4yibn-p7g4.com
com
f6x4yibn-p7g4.com
79
freefotostock.com
freefotostock.com
freefotostock
17
https:// www. freefotostock.com
com
freefotostock.com
80
fayesfairyfinds.com
fayesfairyfinds.com
fayesfairyfinds
19
https:// www. fayesfairyfinds.com
com
fayesfairyfinds.com
81
fho97.com
fho97.com
fho97
9
https:// www. fho97.com
com
fho97.com
82
fhjrtso.com
fhjrtso.com
fhjrtso
11
https:// www. fhjrtso.com
com
fhjrtso.com
83
frogspecialty.com
frogspecialty.com
frogspecialty
17
https:// www. frogspecialty.com
com
frogspecialty.com
84
fuelppt.com
fuelppt.com
fuelppt
11
https:// www. fuelppt.com
com
fuelppt.com
85
familylawhighassetspecialist.com
familylawhighassetspecialist.com
familylawhighassetspecialist
32
https:// www. familylawhighassetspecialist.com
com
familylawhighassetspecialist.com
86
fidescargo.com
fidescargo.com
fidescargo
14
https:// www. fidescargo.com
com
fidescargo.com
87
foreverriggins.com
foreverriggins.com
foreverriggins
18
https:// www. foreverriggins.com
com
foreverriggins.com
88
falloutshelter511.com
falloutshelter511.com
falloutshelter511
21
https:// www. falloutshelter511.com
com
falloutshelter511.com
89
fifacash88a.com
fifacash88a.com
fifacash88a
15
https:// www. fifacash88a.com
com
fifacash88a.com
90
faithnotbysight.com
faithnotbysight.com
faithnotbysight
19
https:// www. faithnotbysight.com
com
faithnotbysight.com
91
firstgr0up.com
firstgr0up.com
firstgr0up
14
https:// www. firstgr0up.com
com
firstgr0up.com
92
famrok.com
famrok.com
famrok
10
https:// www. famrok.com
com
famrok.com
93
foxxfitstudio.com
foxxfitstudio.com
foxxfitstudio
17
https:// www. foxxfitstudio.com
com
foxxfitstudio.com
94
fire1o.com
fire1o.com
fire1o
10
https:// www. fire1o.com
com
fire1o.com
95
feranita.com
feranita.com
feranita
12
https:// www. feranita.com
com
feranita.com
96
fermwear.com
fermwear.com
fermwear
12
https:// www. fermwear.com
com
fermwear.com
97
flowervalleynews.com
flowervalleynews.com
flowervalleynews
20
https:// www. flowervalleynews.com
com
flowervalleynews.com
98
foundationdoctortn.com
foundationdoctortn.com
foundationdoctortn
22
https:// www. foundationdoctortn.com
com
foundationdoctortn.com
99
f6rs.com
f6rs.com
f6rs
8
https:// www. f6rs.com
com
f6rs.com
100
fajasvel.com
fajasvel.com
fajasvel
12
https:// www. fajasvel.com
com
fajasvel.com
101
financialfungenda.com
financialfungenda.com
financialfungenda
21
https:// www. financialfungenda.com
com
financialfungenda.com
102
fixmyonlinestore.com
fixmyonlinestore.com
fixmyonlinestore
20
https:// www. fixmyonlinestore.com
com
fixmyonlinestore.com
103
zcec.net
zcec.net
zcec
8
https:// www. zcec.net
net
zcec.net
104
fendiyachts.com
fendiyachts.com
fendiyachts
15
https:// www. fendiyachts.com
com
fendiyachts.com
105
firstgoatse.com
firstgoatse.com
firstgoatse
15
https:// www. firstgoatse.com
com
firstgoatse.com
106
feresoft.com
feresoft.com
feresoft
12
https:// www. feresoft.com
com
feresoft.com
107
flexakidsworld.com
flexakidsworld.com
flexakidsworld
18
https:// www. flexakidsworld.com
com
flexakidsworld.com
108
fashionluxy.com
fashionluxy.com
fashionluxy
15
https:// www. fashionluxy.com
com
fashionluxy.com
109
ftlauderdaleflrealtors.com
ftlauderdaleflrealtors.com
ftlauderdaleflrealtors
26
https:// www. ftlauderdaleflrealtors.com
com
ftlauderdaleflrealtors.com
110
floweroflifepharmaceutical.com
floweroflifepharmaceutical.com
floweroflifepharmaceutical
30
https:// www. floweroflifepharmaceutical.com
com
floweroflifepharmaceutical.com
111
famskool.com
famskool.com
famskool
12
https:// www. famskool.com
com
famskool.com
112
fabsheen.com
fabsheen.com
fabsheen
12
https:// www. fabsheen.com
com
fabsheen.com
113
frapaanes.com
frapaanes.com
frapaanes
13
https:// www. frapaanes.com
com
frapaanes.com
114
f6sc7etq-n843.com
f6sc7etq-n843.com
f6sc7etq-n843
17
https:// www. f6sc7etq-n843.com
com
f6sc7etq-n843.com
115
flextendibles.com
flextendibles.com
flextendibles
17
https:// www. flextendibles.com
com
flextendibles.com
116
flameandgrate.com
flameandgrate.com
flameandgrate
17
https:// www. flameandgrate.com
com
flameandgrate.com
117
flashpassedu.com
flashpassedu.com
flashpassedu
16
https:// www. flashpassedu.com
com
flashpassedu.com
118
faithcaste.com
faithcaste.com
faithcaste
14
https:// www. faithcaste.com
com
faithcaste.com
119
freespirtbingo.com
freespirtbingo.com
freespirtbingo
18
https:// www. freespirtbingo.com
com
freespirtbingo.com
120
ffz22.com
ffz22.com
ffz22
9
https:// www. ffz22.com
com
ffz22.com
121
fidacebu.com
fidacebu.com
fidacebu
12
https:// www. fidacebu.com
com
fidacebu.com
122
fiacurated.com
fiacurated.com
fiacurated
14
https:// www. fiacurated.com
com
fiacurated.com
123
f5tea.com
f5tea.com
f5tea
9
https:// www. f5tea.com
com
f5tea.com
124
factacompliancesetlement.com
factacompliancesetlement.com
factacompliancesetlement
28
https:// www. factacompliancesetlement.com
com
factacompliancesetlement.com
125
fgamaliel.com
fgamaliel.com
fgamaliel
13
https:// www. fgamaliel.com
com
fgamaliel.com
126
foodscalehub.com
foodscalehub.com
foodscalehub
16
https:// www. foodscalehub.com
com
foodscalehub.com
127
fashionroyalboutique.com
fashionroyalboutique.com
fashionroyalboutique
24
https:// www. fashionroyalboutique.com
com
fashionroyalboutique.com
128
fitnessbodypro.com
fitnessbodypro.com
fitnessbodypro
18
https:// www. fitnessbodypro.com
com
fitnessbodypro.com
129
fasciamastery.com
fasciamastery.com
fasciamastery
17
https:// www. fasciamastery.com
com
fasciamastery.com
130
firstchoicecouriermovers.com
firstchoicecouriermovers.com
firstchoicecouriermovers
28
https:// www. firstchoicecouriermovers.com
com
firstchoicecouriermovers.com
131
flagstoneassoc.com
flagstoneassoc.com
flagstoneassoc
18
https:// www. flagstoneassoc.com
com
flagstoneassoc.com
132
freya-riordan.com
freya-riordan.com
freya-riordan
17
https:// www. freya-riordan.com
com
freya-riordan.com
133
ffh22.com
ffh22.com
ffh22
9
https:// www. ffh22.com
com
ffh22.com
134
famsedge.com
famsedge.com
famsedge
12
https:// www. famsedge.com
com
famsedge.com
135
fenixrosedesigns.com
fenixrosedesigns.com
fenixrosedesigns
20
https:// www. fenixrosedesigns.com
com
fenixrosedesigns.com
136
flamovers.com
flamovers.com
flamovers
13
https:// www. flamovers.com
com
flamovers.com
137
feisign.com
feisign.com
feisign
11
https:// www. feisign.com
com
feisign.com
138
finest-fruits.com
finest-fruits.com
finest-fruits
17
https:// www. finest-fruits.com
com
finest-fruits.com
139
fauyseso.com
fauyseso.com
fauyseso
12
https:// www. fauyseso.com
com
fauyseso.com
140
furbabylovin.com
furbabylovin.com
furbabylovin
16
https:// www. furbabylovin.com
com
furbabylovin.com
141
fandblive.com
fandblive.com
fandblive
13
https:// www. fandblive.com
com
fandblive.com
142
faromen.com
faromen.com
faromen
11
https:// www. faromen.com
com
faromen.com
143
fivestarvacationrentalscam.com
fivestarvacationrentalscam.com
fivestarvacationrentalscam
30
https:// www. fivestarvacationrentalscam.com
com
fivestarvacationrentalscam.com
144
fiorfruitmerchants.com
fiorfruitmerchants.com
fiorfruitmerchants
22
https:// www. fiorfruitmerchants.com
com
fiorfruitmerchants.com
145
foodmodelslove.com
foodmodelslove.com
foodmodelslove
18
https:// www. foodmodelslove.com
com
foodmodelslove.com
146
fototobudka.com
fototobudka.com
fototobudka
15
https:// www. fototobudka.com
com
fototobudka.com
147
fapalo.com
fapalo.com
fapalo
10
https:// www. fapalo.com
com
fapalo.com
148
fashionwigstyle.com
fashionwigstyle.com
fashionwigstyle
19
https:// www. fashionwigstyle.com
com
fashionwigstyle.com
149
fashionblog-fun-life.com
fashionblog-fun-life.com
fashionblog-fun-life
24
https:// www. fashionblog-fun-life.com
com
fashionblog-fun-life.com
150
freyariordan.com
freyariordan.com
freyariordan
16
https:// www. freyariordan.com
com
freyariordan.com
151
flexbattle.com
flexbattle.com
flexbattle
14
https:// www. flexbattle.com
com
flexbattle.com
152
feuerhoelzer.com
feuerhoelzer.com
feuerhoelzer
16
https:// www. feuerhoelzer.com
com
feuerhoelzer.com
153
fyzvonf.com
fyzvonf.com
fyzvonf
11
https:// www. fyzvonf.com
com
fyzvonf.com
154
freebeniciacma.com
freebeniciacma.com
freebeniciacma
18
https:// www. freebeniciacma.com
com
freebeniciacma.com
155
floridapick4.com
floridapick4.com
floridapick4
16
https:// www. floridapick4.com
com
floridapick4.com
156
filmstreaming10.com
filmstreaming10.com
filmstreaming10
19
https:// www. filmstreaming10.com
com
filmstreaming10.com
157
fft55.com
fft55.com
fft55
9
https:// www. fft55.com
com
fft55.com
158
ffq99.com
ffq99.com
ffq99
9
https:// www. ffq99.com
com
ffq99.com
159
failyharvest.com
failyharvest.com
failyharvest
16
https:// www. failyharvest.com
com
failyharvest.com
160
floresvanessa.com
floresvanessa.com
floresvanessa
17
https:// www. floresvanessa.com
com
floresvanessa.com
161
france-plus-assurance.com
france-plus-assurance.com
france-plus-assurance
25
https:// www. france-plus-assurance.com
com
france-plus-assurance.com
162
fitnessismyadvice.com
fitnessismyadvice.com
fitnessismyadvice
21
https:// www. fitnessismyadvice.com
com
fitnessismyadvice.com
163
fetintranet.com
fetintranet.com
fetintranet
15
https:// www. fetintranet.com
com
fetintranet.com
164
findhomeboise.com
findhomeboise.com
findhomeboise
17
https:// www. findhomeboise.com
com
findhomeboise.com
165
fortress-techgroup.com
fortress-techgroup.com
fortress-techgroup
22
https:// www. fortress-techgroup.com
com
fortress-techgroup.com
166
fortnitefont.com
fortnitefont.com
fortnitefont
16
https:// www. fortnitefont.com
com
fortnitefont.com
167
flamingobeauties.com
flamingobeauties.com
flamingobeauties
20
https:// www. flamingobeauties.com
com
flamingobeauties.com
168
favershamrecreationbowlingclub.com
favershamrecreationbowlingclub.com
favershamrecreationbowlingclub
34
https:// www. favershamrecreationbowlingclub.com
com
favershamrecreationbowlingclub.com
169
freshgacha.com
freshgacha.com
freshgacha
14
https:// www. freshgacha.com
com
freshgacha.com
170
fiftyisfun.com
fiftyisfun.com
fiftyisfun
14
https:// www. fiftyisfun.com
com
fiftyisfun.com
171
fishingwiththefans.com
fishingwiththefans.com
fishingwiththefans
22
https:// www. fishingwiththefans.com
com
fishingwiththefans.com
172
farelogroup.com
farelogroup.com
farelogroup
15
https:// www. farelogroup.com
com
farelogroup.com
173
fxsgmmw.com
fxsgmmw.com
fxsgmmw
11
https:// www. fxsgmmw.com
com
fxsgmmw.com
174
fabioschaefer.com
fabioschaefer.com
fabioschaefer
17
https:// www. fabioschaefer.com
com
fabioschaefer.com
175
flavorcapacity.com
flavorcapacity.com
flavorcapacity
18
https:// www. flavorcapacity.com
com
flavorcapacity.com
176
fethiyeemlakgayrimenkul.com
fethiyeemlakgayrimenkul.com
fethiyeemlakgayrimenkul
27
https:// www. fethiyeemlakgayrimenkul.com
com
fethiyeemlakgayrimenkul.com
177
fraulein-holle.com
fraulein-holle.com
fraulein-holle
18
https:// www. fraulein-holle.com
com
fraulein-holle.com
178
formalegacy.com
formalegacy.com
formalegacy
15
https:// www. formalegacy.com
com
formalegacy.com
179
freefrequentmiles.com
freefrequentmiles.com
freefrequentmiles
21
https:// www. freefrequentmiles.com
com
freefrequentmiles.com
180
fanfake.com
fanfake.com
fanfake
11
https:// www. fanfake.com
com
fanfake.com
181
fccdom.com
fccdom.com
fccdom
10
https:// www. fccdom.com
com
fccdom.com
182
fbbizgs.com
fbbizgs.com
fbbizgs
11
https:// www. fbbizgs.com
com
fbbizgs.com
183
ffp22.com
ffp22.com
ffp22
9
https:// www. ffp22.com
com
ffp22.com
184
fethiyebay.com
fethiyebay.com
fethiyebay
14
https:// www. fethiyebay.com
com
fethiyebay.com
185
fetchaus.com
fetchaus.com
fetchaus
12
https:// www. fetchaus.com
com
fetchaus.com
186
faldasmoda.com
faldasmoda.com
faldasmoda
14
https:// www. faldasmoda.com
com
faldasmoda.com
187
faaparis.com
faaparis.com
faaparis
12
https:// www. faaparis.com
com
faaparis.com
188
fitmajig.com
fitmajig.com
fitmajig
12
https:// www. fitmajig.com
com
fitmajig.com
189
fluffy-fashion.com
fluffy-fashion.com
fluffy-fashion
18
https:// www. fluffy-fashion.com
com
fluffy-fashion.com
190
fmm66.com
fmm66.com
fmm66
9
https:// www. fmm66.com
com
fmm66.com
191
facelift-aid.com
facelift-aid.com
facelift-aid
16
https:// www. facelift-aid.com
com
facelift-aid.com
192
fairfaxcityresturantweek.com
fairfaxcityresturantweek.com
fairfaxcityresturantweek
28
https:// www. fairfaxcityresturantweek.com
com
fairfaxcityresturantweek.com
193
firamew.com
firamew.com
firamew
11
https:// www. firamew.com
com
firamew.com
194
floes247.com
floes247.com
floes247
12
https:// www. floes247.com
com
floes247.com
195
findssales.com
findssales.com
findssales
14
https:// www. findssales.com
com
findssales.com
196
foxxews.com
foxxews.com
foxxews
11
https:// www. foxxews.com
com
foxxews.com
197
fightbackcoin.com
fightbackcoin.com
fightbackcoin
17
https:// www. fightbackcoin.com
com
fightbackcoin.com
198
ffs99.com
ffs99.com
ffs99
9
https:// www. ffs99.com
com
ffs99.com
199
financexus.com
financexus.com
financexus
14
https:// www. financexus.com
com
financexus.com
200
flow-active.com
flow-active.com
flow-active
15
https:// www. flow-active.com
com
flow-active.com
201
fugu-digital.com
fugu-digital.com
fugu-digital
16
https:// www. fugu-digital.com
com
fugu-digital.com
202
finishelevation.com
finishelevation.com
finishelevation
19
https:// www. finishelevation.com
com
finishelevation.com
203
farouttoothdecor.com
farouttoothdecor.com
farouttoothdecor
20
https:// www. farouttoothdecor.com
com
farouttoothdecor.com
204
fundsforthem.com
fundsforthem.com
fundsforthem
16
https:// www. fundsforthem.com
com
fundsforthem.com
205
fakelashesgonewrong.com
fakelashesgonewrong.com
fakelashesgonewrong
23
https:// www. fakelashesgonewrong.com
com
fakelashesgonewrong.com
206
fanstasypros.com
fanstasypros.com
fanstasypros
16
https:// www. fanstasypros.com
com
fanstasypros.com
207
forsythemultinational.com
forsythemultinational.com
forsythemultinational
25
https:// www. forsythemultinational.com
com
forsythemultinational.com
208
fusionaudiopost.com
fusionaudiopost.com
fusionaudiopost
19
https:// www. fusionaudiopost.com
com
fusionaudiopost.com
209
fedrifamilystories.com
fedrifamilystories.com
fedrifamilystories
22
https:// www. fedrifamilystories.com
com
fedrifamilystories.com
210
fallingstarspices.com
fallingstarspices.com
fallingstarspices
21
https:// www. fallingstarspices.com
com
fallingstarspices.com
211
fibercavities.com
fibercavities.com
fibercavities
17
https:// www. fibercavities.com
com
fibercavities.com
212
fashionlnn.com
fashionlnn.com
fashionlnn
14
https:// www. fashionlnn.com
com
fashionlnn.com
213
farmmesa.com
farmmesa.com
farmmesa
12
https:// www. farmmesa.com
com
farmmesa.com
214
fournisseurs-companeo.com
fournisseurs-companeo.com
fournisseurs-companeo
25
https:// www. fournisseurs-companeo.com
com
fournisseurs-companeo.com
215
fastestwave.com
fastestwave.com
fastestwave
15
https:// www. fastestwave.com
com
fastestwave.com
216
fernglenlot.com
fernglenlot.com
fernglenlot
15
https:// www. fernglenlot.com
com
fernglenlot.com
217
fivetencbd.com
fivetencbd.com
fivetencbd
14
https:// www. fivetencbd.com
com
fivetencbd.com
218
fidamex.com
fidamex.com
fidamex
11
https:// www. fidamex.com
com
fidamex.com
219
freeshotgirls.com
freeshotgirls.com
freeshotgirls
17
https:// www. freeshotgirls.com
com
freeshotgirls.com
220
ferchaz.com
ferchaz.com
ferchaz
11
https:// www. ferchaz.com
com
ferchaz.com
221
fundthatfilm.com
fundthatfilm.com
fundthatfilm
16
https:// www. fundthatfilm.com
com
fundthatfilm.com
222
farniaco.com
farniaco.com
farniaco
12
https:// www. farniaco.com
com
farniaco.com
223
factoryvillefire.com
factoryvillefire.com
factoryvillefire
20
https:// www. factoryvillefire.com
com
factoryvillefire.com
224
fww77.com
fww77.com
fww77
9
https:// www. fww77.com
com
fww77.com
225
ffximovies.com
ffximovies.com
ffximovies
14
https:// www. ffximovies.com
com
ffximovies.com
226
freeholdsavaingsandloan.com
freeholdsavaingsandloan.com
freeholdsavaingsandloan
27
https:// www. freeholdsavaingsandloan.com
com
freeholdsavaingsandloan.com
227
fairfaxcountyinjuredworkers.com
fairfaxcountyinjuredworkers.com
fairfaxcountyinjuredworkers
31
https:// www. fairfaxcountyinjuredworkers.com
com
fairfaxcountyinjuredworkers.com
228
franchiseawe.com
franchiseawe.com
franchiseawe
16
https:// www. franchiseawe.com
com
franchiseawe.com
229
festifituk.com
festifituk.com
festifituk
14
https:// www. festifituk.com
com
festifituk.com
230
favedcosmetics.com
favedcosmetics.com
favedcosmetics
18
https:// www. favedcosmetics.com
com
favedcosmetics.com
231
fasterresultsacademy.com
fasterresultsacademy.com
fasterresultsacademy
24
https:// www. fasterresultsacademy.com
com
fasterresultsacademy.com
232
firstgreeneg.com
firstgreeneg.com
firstgreeneg
16
https:// www. firstgreeneg.com
com
firstgreeneg.com
233
frontierdelcaribe.com
frontierdelcaribe.com
frontierdelcaribe
21
https:// www. frontierdelcaribe.com
com
frontierdelcaribe.com
234
freerummy.com
freerummy.com
freerummy
13
https:// www. freerummy.com
com
freerummy.com
235
foreseenfilms.com
foreseenfilms.com
foreseenfilms
17
https:// www. foreseenfilms.com
com
foreseenfilms.com
236
foxandhoundlandscaping.com
foxandhoundlandscaping.com
foxandhoundlandscaping
26
https:// www. foxandhoundlandscaping.com
com
foxandhoundlandscaping.com
237
frankslawnandtree.com
frankslawnandtree.com
frankslawnandtree
21
https:// www. frankslawnandtree.com
com
frankslawnandtree.com
238
ffxzbl.com
ffxzbl.com
ffxzbl
10
https:// www. ffxzbl.com
com
ffxzbl.com
239
fho78.com
fho78.com
fho78
9
https:// www. fho78.com
com
fho78.com
240
fjj77.com
fjj77.com
fjj77
9
https:// www. fjj77.com
com
fjj77.com
241
familylawhighassetspecialists.com
familylawhighassetspecialists.com
familylawhighassetspecialists
33
https:// www. familylawhighassetspecialists.com
com
familylawhighassetspecialists.com
242
fsrite.com
fsrite.com
fsrite
10
https:// www. fsrite.com
com
fsrite.com
243
fairwayrecruitingeast.com
fairwayrecruitingeast.com
fairwayrecruitingeast
25
https:// www. fairwayrecruitingeast.com
com
fairwayrecruitingeast.com
244
flatearthprinciple.com
flatearthprinciple.com
flatearthprinciple
22
https:// www. flatearthprinciple.com
com
flatearthprinciple.com
245
fieldsfieldsfields.com
fieldsfieldsfields.com
fieldsfieldsfields
22
https:// www. fieldsfieldsfields.com
com
fieldsfieldsfields.com
246
farnerware.com
farnerware.com
farnerware
14
https:// www. farnerware.com
com
farnerware.com
247
facenawe.com
facenawe.com
facenawe
12
https:// www. facenawe.com
com
facenawe.com
248
fashionassassinsplustique.com
fashionassassinsplustique.com
fashionassassinsplustique
29
https:// www. fashionassassinsplustique.com
com
fashionassassinsplustique.com
249
fanbaili.com
fanbaili.com
fanbaili
12
https:// www. fanbaili.com
com
fanbaili.com
250
fishandponds.com
fishandponds.com
fishandponds
16
https:// www. fishandponds.com
com
fishandponds.com
251
freecasual***partner.com
freecasual***partner.com
freecasualsexpartner
24
https:// www. freecasual***partner.com
com
freecasualsexpartner.com
252
feminamodabsas.com
feminamodabsas.com
feminamodabsas
18
https:// www. feminamodabsas.com
com
feminamodabsas.com
253
fortunetechtips.com
fortunetechtips.com
fortunetechtips
19
https:// www. fortunetechtips.com
com
fortunetechtips.com
254
full-post.com
full-post.com
full-post
13
https:// www. full-post.com
com
full-post.com
255
fashionlaglam.com
fashionlaglam.com
fashionlaglam
17
https:// www. fashionlaglam.com
com
fashionlaglam.com
256
firewatchguardcertification.com
firewatchguardcertification.com
firewatchguardcertification
31
https:// www. firewatchguardcertification.com
com
firewatchguardcertification.com
257
fdppj.com
fdppj.com
fdppj
9
https:// www. fdppj.com
com
fdppj.com
258
fitforchanges.com
fitforchanges.com
fitforchanges
17
https:// www. fitforchanges.com
com
fitforchanges.com
259
fylnnrg.com
fylnnrg.com
fylnnrg
11
https:// www. fylnnrg.com
com
fylnnrg.com
260
familylawattorneyphoenix.com
familylawattorneyphoenix.com
familylawattorneyphoenix
28
https:// www. familylawattorneyphoenix.com
com
familylawattorneyphoenix.com
261
fallingrockllc.com
fallingrockllc.com
fallingrockllc
18
https:// www. fallingrockllc.com
com
fallingrockllc.com
262
foldmobiles.com
foldmobiles.com
foldmobiles
15
https:// www. foldmobiles.com
com
foldmobiles.com
263
firetreeseo.com
firetreeseo.com
firetreeseo
15
https:// www. firetreeseo.com
com
firetreeseo.com
264
fho82.com
fho82.com
fho82
9
https:// www. fho82.com
com
fho82.com
265
flyingsams.com
flyingsams.com
flyingsams
14
https:// www. flyingsams.com
com
flyingsams.com
266
federalbluedental.com
federalbluedental.com
federalbluedental
21
https:// www. federalbluedental.com
com
federalbluedental.com
267
fmm55.com
fmm55.com
fmm55
9
https:// www. fmm55.com
com
fmm55.com
268
foch-marrakech.com
foch-marrakech.com
foch-marrakech
18
https:// www. foch-marrakech.com
com
foch-marrakech.com
269
fmelectrickft.com
fmelectrickft.com
fmelectrickft
17
https:// www. fmelectrickft.com
com
fmelectrickft.com
270
fhhlb.com
fhhlb.com
fhhlb
9
https:// www. fhhlb.com
com
fhhlb.com
271
flavless.com
flavless.com
flavless
12
https:// www. flavless.com
com
flavless.com
272
fwtbol.com
fwtbol.com
fwtbol
10
https:// www. fwtbol.com
com
fwtbol.com
273
fanlinsf.com
fanlinsf.com
fanlinsf
12
https:// www. fanlinsf.com
com
fanlinsf.com
274
fireworkads.com
fireworkads.com
fireworkads
15
https:// www. fireworkads.com
com
fireworkads.com
275
fineomtechnologies.com
fineomtechnologies.com
fineomtechnologies
22
https:// www. fineomtechnologies.com
com
fineomtechnologies.com
276
foodiligence.com
foodiligence.com
foodiligence
16
https:// www. foodiligence.com
com
foodiligence.com
277
fashionwatchbrand.com
fashionwatchbrand.com
fashionwatchbrand
21
https:// www. fashionwatchbrand.com
com
fashionwatchbrand.com
278
fallonukpeellis.com
fallonukpeellis.com
fallonukpeellis
19
https:// www. fallonukpeellis.com
com
fallonukpeellis.com
279
forthrightlighting.com
forthrightlighting.com
forthrightlighting
22
https:// www. forthrightlighting.com
com
forthrightlighting.com
280
fromkindergartenwithlove.com
fromkindergartenwithlove.com
fromkindergartenwithlove
28
https:// www. fromkindergartenwithlove.com
com
fromkindergartenwithlove.com
281
freehomebuyersinfo.com
freehomebuyersinfo.com
freehomebuyersinfo
22
https:// www. freehomebuyersinfo.com
com
freehomebuyersinfo.com
282
farhatiptv.com
farhatiptv.com
farhatiptv
14
https:// www. farhatiptv.com
com
farhatiptv.com
283
foam-omaha.com
foam-omaha.com
foam-omaha
14
https:// www. foam-omaha.com
com
foam-omaha.com
284
freeonlinegamesforyourwebsite.com
freeonlinegamesforyourwebsite.com
freeonlinegamesforyourwebsite
33
https:// www. freeonlinegamesforyourwebsite.com
com
freeonlinegamesforyourwebsite.com
285
fitmargin.com
fitmargin.com
fitmargin
13
https:// www. fitmargin.com
com
fitmargin.com
286
fahadkhawaji.com
fahadkhawaji.com
fahadkhawaji
16
https:// www. fahadkhawaji.com
com
fahadkhawaji.com
287
foosiesoaps.com
foosiesoaps.com
foosiesoaps
15
https:// www. foosiesoaps.com
com
foosiesoaps.com
288
filtergadget.com
filtergadget.com
filtergadget
16
https:// www. filtergadget.com
com
filtergadget.com
289
fanchatstic.com
fanchatstic.com
fanchatstic
15
https:// www. fanchatstic.com
com
fanchatstic.com
290
fleetmainscape.com
fleetmainscape.com
fleetmainscape
18
https:// www. fleetmainscape.com
com
fleetmainscape.com
291
fmrcjcv.com
fmrcjcv.com
fmrcjcv
11
https:// www. fmrcjcv.com
com
fmrcjcv.com
292
fangkuaisi.com
fangkuaisi.com
fangkuaisi
14
https:// www. fangkuaisi.com
com
fangkuaisi.com
293
freeworkingg.com
freeworkingg.com
freeworkingg
16
https:// www. freeworkingg.com
com
freeworkingg.com
294
facultyoflife.com
facultyoflife.com
facultyoflife
17
https:// www. facultyoflife.com
com
facultyoflife.com
295
fjsjzwx.com
fjsjzwx.com
fjsjzwx
11
https:// www. fjsjzwx.com
com
fjsjzwx.com
296
ffy55.com
ffy55.com
ffy55
9
https:// www. ffy55.com
com
ffy55.com
297
fiberchecker.com
fiberchecker.com
fiberchecker
16
https:// www. fiberchecker.com
com
fiberchecker.com
298
freefreefreetrafficschool.com
freefreefreetrafficschool.com
freefreefreetrafficschool
29
https:// www. freefreefreetrafficschool.com
com
freefreefreetrafficschool.com
299
fjjinye.com
fjjinye.com
fjjinye
11
https:// www. fjjinye.com
com
fjjinye.com
300
fastactioncpr.com
fastactioncpr.com
fastactioncpr
17
https:// www. fastactioncpr.com
com
fastactioncpr.com
301
faithnehila.com
faithnehila.com
faithnehila
15
https:// www. faithnehila.com
com
faithnehila.com
302
footballistik.com
footballistik.com
footballistik
17
https:// www. footballistik.com
com
footballistik.com
303
farrislife.com
farrislife.com
farrislife
14
https:// www. farrislife.com
com
farrislife.com
304
famliyhealingwithsara.com
famliyhealingwithsara.com
famliyhealingwithsara
25
https:// www. famliyhealingwithsara.com
com
famliyhealingwithsara.com
305
faharihelps.com
faharihelps.com
faharihelps
15
https:// www. faharihelps.com
com
faharihelps.com
306
feraho.com
feraho.com
feraho
10
https:// www. feraho.com
com
feraho.com
307
fragranntica.com
fragranntica.com
fragranntica
16
https:// www. fragranntica.com
com
fragranntica.com
308
fenghualian.com
fenghualian.com
fenghualian
15
https:// www. fenghualian.com
com
fenghualian.com
309
fcbirthcenter.com
fcbirthcenter.com
fcbirthcenter
17
https:// www. fcbirthcenter.com
com
fcbirthcenter.com
310
fraseraircompliance.com
fraseraircompliance.com
fraseraircompliance
23
https:// www. fraseraircompliance.com
com
fraseraircompliance.com
311
faceliftingfood.com
faceliftingfood.com
faceliftingfood
19
https:// www. faceliftingfood.com
com
faceliftingfood.com
312
foreplaygolfing.com
foreplaygolfing.com
foreplaygolfing
19
https:// www. foreplaygolfing.com
com
foreplaygolfing.com
313
fenerbahcemaclari.com
fenerbahcemaclari.com
fenerbahcemaclari
21
https:// www. fenerbahcemaclari.com
com
fenerbahcemaclari.com
314
fifa55centerback.com
fifa55centerback.com
fifa55centerback
20
https:// www. fifa55centerback.com
com
fifa55centerback.com
315
fhqpyl.com
fhqpyl.com
fhqpyl
10
https:// www. fhqpyl.com
com
fhqpyl.com
316
ferreafire.com
ferreafire.com
ferreafire
14
https:// www. ferreafire.com
com
ferreafire.com
317
financialstaffer.com
financialstaffer.com
financialstaffer
20
https:// www. financialstaffer.com
com
financialstaffer.com
318
familylawcomplexassetsspecialist.com
familylawcomplexassetsspecialist.com
familylawcomplexassetsspecialist
36
https:// www. familylawcomplexassetsspecialist.com
com
familylawcomplexassetsspecialist.com
319
freshmodernhouse.com
freshmodernhouse.com
freshmodernhouse
20
https:// www. freshmodernhouse.com
com
freshmodernhouse.com
320
fdpdx.com
fdpdx.com
fdpdx
9
https:// www. fdpdx.com
com
fdpdx.com
321
fighterblueprint.com
fighterblueprint.com
fighterblueprint
20
https:// www. fighterblueprint.com
com
fighterblueprint.com
322
feelingoodlkn.com
feelingoodlkn.com
feelingoodlkn
17
https:// www. feelingoodlkn.com
com
feelingoodlkn.com
323
freebeyondbelief.com
freebeyondbelief.com
freebeyondbelief
20
https:// www. freebeyondbelief.com
com
freebeyondbelief.com
324
fourmulafocus.com
fourmulafocus.com
fourmulafocus
17
https:// www. fourmulafocus.com
com
fourmulafocus.com
325
foranimalz.com
foranimalz.com
foranimalz
14
https:// www. foranimalz.com
com
foranimalz.com
326
fanyihuipin.com
fanyihuipin.com
fanyihuipin
15
https:// www. fanyihuipin.com
com
fanyihuipin.com
327
formcrowd.com
formcrowd.com
formcrowd
13
https:// www. formcrowd.com
com
formcrowd.com
328
feminineprinciples.com
feminineprinciples.com
feminineprinciples
22
https:// www. feminineprinciples.com
com
feminineprinciples.com
329
farmacia-demo.com
farmacia-demo.com
farmacia-demo
17
https:// www. farmacia-demo.com
com
farmacia-demo.com
330
fanllorybeauty.com
fanllorybeauty.com
fanllorybeauty
18
https:// www. fanllorybeauty.com
com
fanllorybeauty.com
331
fifaclin.com
fifaclin.com
fifaclin
12
https:// www. fifaclin.com
com
fifaclin.com
332
freelz.com
freelz.com
freelz
10
https:// www. freelz.com
com
freelz.com
333
ferbund.com
ferbund.com
ferbund
11
https:// www. ferbund.com
com
ferbund.com
334
fireislandfarmhouse.com
fireislandfarmhouse.com
fireislandfarmhouse
23
https:// www. fireislandfarmhouse.com
com
fireislandfarmhouse.com
335
fourcornersautomotive.com
fourcornersautomotive.com
fourcornersautomotive
25
https:// www. fourcornersautomotive.com
com
fourcornersautomotive.com
336
fixmyfiction.com
fixmyfiction.com
fixmyfiction
16
https:// www. fixmyfiction.com
com
fixmyfiction.com
337
felitasfabfinds.com
felitasfabfinds.com
felitasfabfinds
19
https:// www. felitasfabfinds.com
com
felitasfabfinds.com
338
faradilamahri.com
faradilamahri.com
faradilamahri
17
https:// www. faradilamahri.com
com
faradilamahri.com
339
filajobapplication.com
filajobapplication.com
filajobapplication
22
https:// www. filajobapplication.com
com
filajobapplication.com
340
feuwa.com
feuwa.com
feuwa
9
https:// www. feuwa.com
com
feuwa.com
341
fho51.com
fho51.com
fho51
9
https:// www. fho51.com
com
fho51.com
342
fourmybrothersmovie.com
fourmybrothersmovie.com
fourmybrothersmovie
23
https:// www. fourmybrothersmovie.com
com
fourmybrothersmovie.com
343
foundrgroup.com
foundrgroup.com
foundrgroup
15
https:// www. foundrgroup.com
com
foundrgroup.com
344
fatlossflow.com
fatlossflow.com
fatlossflow
15
https:// www. fatlossflow.com
com
fatlossflow.com
345
fluffybuddie.com
fluffybuddie.com
fluffybuddie
16
https:// www. fluffybuddie.com
com
fluffybuddie.com
346
fandankj.com
fandankj.com
fandankj
12
https:// www. fandankj.com
com
fandankj.com
347
fashionbyeco.com
fashionbyeco.com
fashionbyeco
16
https:// www. fashionbyeco.com
com
fashionbyeco.com
348
forraversbyravers.com
forraversbyravers.com
forraversbyravers
21
https:// www. forraversbyravers.com
com
forraversbyravers.com
349
fkingawesome.com
fkingawesome.com
fkingawesome
16
https:// www. fkingawesome.com
com
fkingawesome.com
350
fho62.com
fho62.com
fho62
9
https:// www. fho62.com
com
fho62.com
351
festivalhairwear.com
festivalhairwear.com
festivalhairwear
20
https:// www. festivalhairwear.com
com
festivalhairwear.com
352
flaveryfarms.com
flaveryfarms.com
flaveryfarms
16
https:// www. flaveryfarms.com
com
flaveryfarms.com
353
ffz33.com
ffz33.com
ffz33
9
https:// www. ffz33.com
com
ffz33.com
354
floatiestime.com
floatiestime.com
floatiestime
16
https:// www. floatiestime.com
com
floatiestime.com
355
fhhpl.com
fhhpl.com
fhhpl
9
https:// www. fhhpl.com
com
fhhpl.com
356
familyfinancialconcepts.com
familyfinancialconcepts.com
familyfinancialconcepts
27
https:// www. familyfinancialconcepts.com
com
familyfinancialconcepts.com
357
finditnowcomputer.com
finditnowcomputer.com
finditnowcomputer
21
https:// www. finditnowcomputer.com
com
finditnowcomputer.com
358
francois-bigot.com
francois-bigot.com
francois-bigot
18
https:// www. francois-bigot.com
com
francois-bigot.com
359
fenghuami.com
fenghuami.com
fenghuami
13
https:// www. fenghuami.com
com
fenghuami.com
360
fjjiangu.com
fjjiangu.com
fjjiangu
12
https:// www. fjjiangu.com
com
fjjiangu.com
361
ks20176.com
ks20176.com
ks20176
11
https:// www. ks20176.com
com
ks20176.com
362
fmbzremb.com
fmbzremb.com
fmbzremb
12
https:// www. fmbzremb.com
com
fmbzremb.com
363
ffq77.com
ffq77.com
ffq77
9
https:// www. ffq77.com
com
ffq77.com
364
fcchospitality.com
fcchospitality.com
fcchospitality
18
https:// www. fcchospitality.com
com
fcchospitality.com
365
floridanewhomerebates.com
floridanewhomerebates.com
floridanewhomerebates
25
https:// www. floridanewhomerebates.com
com
floridanewhomerebates.com
366
famous-multimedia.com
famous-multimedia.com
famous-multimedia
21
https:// www. famous-multimedia.com
com
famous-multimedia.com
367
fa-zil.com
fa-zil.com
fa-zil
10
https:// www. fa-zil.com
com
fa-zil.com
368
fasttracksuccessformula.com
fasttracksuccessformula.com
fasttracksuccessformula
27
https:// www. fasttracksuccessformula.com
com
fasttracksuccessformula.com
369
fazalmotorspk.com
fazalmotorspk.com
fazalmotorspk
17
https:// www. fazalmotorspk.com
com
fazalmotorspk.com
370
fandidel.com
fandidel.com
fandidel
12
https:// www. fandidel.com
com
fandidel.com
371
feritdecor.com
feritdecor.com
feritdecor
14
https:// www. feritdecor.com
com
feritdecor.com
372
forsythlink.com
forsythlink.com
forsythlink
15
https:// www. forsythlink.com
com
forsythlink.com
373
faithofwords.com
faithofwords.com
faithofwords
16
https:// www. faithofwords.com
com
faithofwords.com
374
fosjz.com
fosjz.com
fosjz
9
https:// www. fosjz.com
com
fosjz.com
375
finestdishesintheworld.com
finestdishesintheworld.com
finestdishesintheworld
26
https:// www. finestdishesintheworld.com
com
finestdishesintheworld.com
376
forever-roads.com
forever-roads.com
forever-roads
17
https:// www. forever-roads.com
com
forever-roads.com
377
fentanylelf.com
fentanylelf.com
fentanylelf
15
https:// www. fentanylelf.com
com
fentanylelf.com
378
fleetdse.com
fleetdse.com
fleetdse
12
https:// www. fleetdse.com
com
fleetdse.com
379
farrishcar.com
farrishcar.com
farrishcar
14
https:// www. farrishcar.com
com
farrishcar.com
380
findsoid.com
findsoid.com
findsoid
12
https:// www. findsoid.com
com
findsoid.com
381
fooshare.com
fooshare.com
fooshare
12
https:// www. fooshare.com
com
fooshare.com
382
flybornlife.com
flybornlife.com
flybornlife
15
https:// www. flybornlife.com
com
flybornlife.com
383
fflreliashield.com
fflreliashield.com
fflreliashield
18
https:// www. fflreliashield.com
com
fflreliashield.com
384
fellaprints.com
fellaprints.com
fellaprints
15
https:// www. fellaprints.com
com
fellaprints.com
385
faztap.com
faztap.com
faztap
10
https:// www. faztap.com
com
faztap.com
386
fmh-online.com
fmh-online.com
fmh-online
14
https:// www. fmh-online.com
com
fmh-online.com
387
fireissue.com
fireissue.com
fireissue
13
https:// www. fireissue.com
com
fireissue.com
388
financialadvisor-aid.com
financialadvisor-aid.com
financialadvisor-aid
24
https:// www. financialadvisor-aid.com
com
financialadvisor-aid.com
389
freelancer1980f2.com
freelancer1980f2.com
freelancer1980f2
20
https:// www. freelancer1980f2.com
com
freelancer1980f2.com
390
facesbyjade.com
facesbyjade.com
facesbyjade
15
https:// www. facesbyjade.com
com
facesbyjade.com
391
facelt.com
facelt.com
facelt
10
https:// www. facelt.com
com
facelt.com
392
fourty-fifth.com
fourty-fifth.com
fourty-fifth
16
https:// www. fourty-fifth.com
com
fourty-fifth.com
393
familyceremonies.com
familyceremonies.com
familyceremonies
20
https:// www. familyceremonies.com
com
familyceremonies.com
394
forkedriverfarms.com
forkedriverfarms.com
forkedriverfarms
20
https:// www. forkedriverfarms.com
com
forkedriverfarms.com
395
faillamcknight.com
faillamcknight.com
faillamcknight
18
https:// www. faillamcknight.com
com
faillamcknight.com
396
fbspirits.com
fbspirits.com
fbspirits
13
https:// www. fbspirits.com
com
fbspirits.com
397
fallscreekmi.com
fallscreekmi.com
fallscreekmi
16
https:// www. fallscreekmi.com
com
fallscreekmi.com
398
foxwoodwork.com
foxwoodwork.com
foxwoodwork
15
https:// www. foxwoodwork.com
com
foxwoodwork.com
399
feminine-forces.com
feminine-forces.com
feminine-forces
19
https:// www. feminine-forces.com
com
feminine-forces.com
400
fancyfivedollarjewelry.com
fancyfivedollarjewelry.com
fancyfivedollarjewelry
26
https:// www. fancyfivedollarjewelry.com
com
fancyfivedollarjewelry.com
401
fjj99.com
fjj99.com
fjj99
9
https:// www. fjj99.com
com
fjj99.com
402
fessubscribe.com
fessubscribe.com
fessubscribe
16
https:// www. fessubscribe.com
com
fessubscribe.com
403
farmoli.com
farmoli.com
farmoli
11
https:// www. farmoli.com
com
farmoli.com
404
fernfacts.com
fernfacts.com
fernfacts
13
https:// www. fernfacts.com
com
fernfacts.com
405
feminabeautystudio.com
feminabeautystudio.com
feminabeautystudio
22
https:// www. feminabeautystudio.com
com
feminabeautystudio.com
406
freebiesfun.com
freebiesfun.com
freebiesfun
15
https:// www. freebiesfun.com
com
freebiesfun.com
407
flexingrapper.com
flexingrapper.com
flexingrapper
17
https:// www. flexingrapper.com
com
flexingrapper.com
408
fortniteskinclubs.com
fortniteskinclubs.com
fortniteskinclubs
21
https:// www. fortniteskinclubs.com
com
fortniteskinclubs.com
409
fairies-salon.com
fairies-salon.com
fairies-salon
17
https:// www. fairies-salon.com
com
fairies-salon.com
410
fanleixin.com
fanleixin.com
fanleixin
13
https:// www. fanleixin.com
com
fanleixin.com
411
fengshigubing.com
fengshigubing.com
fengshigubing
17
https:// www. fengshigubing.com
com
fengshigubing.com
412
flaviss.com
flaviss.com
flaviss
11
https:// www. flaviss.com
com
flaviss.com
413
ffs55.com
ffs55.com
ffs55
9
https:// www. ffs55.com
com
ffs55.com
414
figuretrunk.com
figuretrunk.com
figuretrunk
15
https:// www. figuretrunk.com
com
figuretrunk.com
415
ff14silva.com
ff14silva.com
ff14silva
13
https:// www. ff14silva.com
com
ff14silva.com
416
finleyauto.com
finleyauto.com
finleyauto
14
https:// www. finleyauto.com
com
finleyauto.com
417
fc53vip.com
fc53vip.com
fc53vip
11
https:// www. fc53vip.com
com
fc53vip.com
418
faridaanwarphd.com
faridaanwarphd.com
faridaanwarphd
18
https:// www. faridaanwarphd.com
com
faridaanwarphd.com
419
feydeway.com
feydeway.com
feydeway
12
https:// www. feydeway.com
com
feydeway.com
420
flavorybite.com
flavorybite.com
flavorybite
15
https:// www. flavorybite.com
com
flavorybite.com
421
familytiestrucking.com
familytiestrucking.com
familytiestrucking
22
https:// www. familytiestrucking.com
com
familytiestrucking.com
422
fitnesscenter4weightloss.com
fitnesscenter4weightloss.com
fitnesscenter4weightloss
28
https:// www. fitnesscenter4weightloss.com
com
fitnesscenter4weightloss.com
423
flowertemplate.com
flowertemplate.com
flowertemplate
18
https:// www. flowertemplate.com
com
flowertemplate.com
424
frutti-cadours.com
frutti-cadours.com
frutti-cadours
18
https:// www. frutti-cadours.com
com
frutti-cadours.com
425
form8996.com
form8996.com
form8996
12
https:// www. form8996.com
com
form8996.com
426
faressamer.com
faressamer.com
faressamer
14
https:// www. faressamer.com
com
faressamer.com
427
flexafy.com
flexafy.com
flexafy
11
https:// www. flexafy.com
com
flexafy.com
428
ferisproducts.com
ferisproducts.com
ferisproducts
17
https:// www. ferisproducts.com
com
ferisproducts.com
429
f-kinomi.com
f-kinomi.com
f-kinomi
12
https:// www. f-kinomi.com
com
f-kinomi.com
430
fazlanicorp.com
fazlanicorp.com
fazlanicorp
15
https:// www. fazlanicorp.com
com
fazlanicorp.com
431
fenghuanqipai.com
fenghuanqipai.com
fenghuanqipai
17
https:// www. fenghuanqipai.com
com
fenghuanqipai.com
432
fg123123.com
fg123123.com
fg123123
12
https:// www. fg123123.com
com
fg123123.com
433
ftpnb.com
ftpnb.com
ftpnb
9
https:// www. ftpnb.com
com
ftpnb.com
434
favorli.com
favorli.com
favorli
11
https:// www. favorli.com
com
favorli.com
435
flexxgaming.com
flexxgaming.com
flexxgaming
15
https:// www. flexxgaming.com
com
flexxgaming.com
436
fitmisswhiz.com
fitmisswhiz.com
fitmisswhiz
15
https:// www. fitmisswhiz.com
com
fitmisswhiz.com
437
fox-militarynews.com
fox-militarynews.com
fox-militarynews
20
https:// www. fox-militarynews.com
com
fox-militarynews.com
438
finalcallac.com
finalcallac.com
finalcallac
15
https:// www. finalcallac.com
com
finalcallac.com
439
fanatixonline.com
fanatixonline.com
fanatixonline
17
https:// www. fanatixonline.com
com
fanatixonline.com
440
freehearts.com
freehearts.com
freehearts
14
https:// www. freehearts.com
com
freehearts.com
441
franksreports.com
franksreports.com
franksreports
17
https:// www. franksreports.com
com
franksreports.com
442
fire5050.com
fire5050.com
fire5050
12
https:// www. fire5050.com
com
fire5050.com
443
familylawcomplexassetsspecialists.com
familylawcomplexassetsspecialists.com
familylawcomplexassetsspecialists
37
https:// www. familylawcomplexassetsspecialists.com
com
familylawcomplexassetsspecialists.com
444
fordbrody.com
fordbrody.com
fordbrody
13
https:// www. fordbrody.com
com
fordbrody.com
445
family-path.com
family-path.com
family-path
15
https:// www. family-path.com
com
family-path.com
446
fabricfoundry.com
fabricfoundry.com
fabricfoundry
17
https:// www. fabricfoundry.com
com
fabricfoundry.com
447
f1tonight.com
f1tonight.com
f1tonight
13
https:// www. f1tonight.com
com
f1tonight.com
448
foxwoodsuites.com
foxwoodsuites.com
foxwoodsuites
17
https:// www. foxwoodsuites.com
com
foxwoodsuites.com
449
fntrose.com
fntrose.com
fntrose
11
https:// www. fntrose.com
com
fntrose.com
450
financialadvisorsfortcollins.com
financialadvisorsfortcollins.com
financialadvisorsfortcollins
32
https:// www. financialadvisorsfortcollins.com
com
financialadvisorsfortcollins.com
451
fryergardens.com
fryergardens.com
fryergardens
16
https:// www. fryergardens.com
com
fryergardens.com
452
flowingmc.com
flowingmc.com
flowingmc
13
https:// www. flowingmc.com
com
flowingmc.com
453
fedvt.com
fedvt.com
fedvt
9
https:// www. fedvt.com
com
fedvt.com
454
frozen-bubble.com
frozen-bubble.com
frozen-bubble
17
https:// www. frozen-bubble.com
com
frozen-bubble.com
455
fangzhiheng.com
fangzhiheng.com
fangzhiheng
15
https:// www. fangzhiheng.com
com
fangzhiheng.com
456
fabricatetheatre.com
fabricatetheatre.com
fabricatetheatre
20
https:// www. fabricatetheatre.com
com
fabricatetheatre.com
457
fartingisnotacrime.com
fartingisnotacrime.com
fartingisnotacrime
22
https:// www. fartingisnotacrime.com
com
fartingisnotacrime.com
458
fnpowerapp.com
fnpowerapp.com
fnpowerapp
14
https:// www. fnpowerapp.com
com
fnpowerapp.com
459
fireandashes.com
fireandashes.com
fireandashes
16
https:// www. fireandashes.com
com
fireandashes.com
460
fabriziroofing.com
fabriziroofing.com
fabriziroofing
18
https:// www. fabriziroofing.com
com
fabriziroofing.com
461
fideliselitesystems.com
fideliselitesystems.com
fideliselitesystems
23
https:// www. fideliselitesystems.com
com
fideliselitesystems.com
462
feralprincesses.com
feralprincesses.com
feralprincesses
19
https:// www. feralprincesses.com
com
feralprincesses.com
463
fourcarts.com
fourcarts.com
fourcarts
13
https:// www. fourcarts.com
com
fourcarts.com
464
farpointsales.com
farpointsales.com
farpointsales
17
https:// www. farpointsales.com
com
farpointsales.com
465
findtherootcausecolumbus.com
findtherootcausecolumbus.com
findtherootcausecolumbus
28
https:// www. findtherootcausecolumbus.com
com
findtherootcausecolumbus.com
466
fortuneroyalmassage.com
fortuneroyalmassage.com
fortuneroyalmassage
23
https:// www. fortuneroyalmassage.com
com
fortuneroyalmassage.com
467
f1ticketszandvoort.com
f1ticketszandvoort.com
f1ticketszandvoort
22
https:// www. f1ticketszandvoort.com
com
f1ticketszandvoort.com
468
funtechgist.com
funtechgist.com
funtechgist
15
https:// www. funtechgist.com
com
funtechgist.com
469
formalloya.com
formalloya.com
formalloya
14
https:// www. formalloya.com
com
formalloya.com
470
fa-japan-meb.com
fa-japan-meb.com
fa-japan-meb
16
https:// www. fa-japan-meb.com
com
fa-japan-meb.com
471
forthrightled.com
forthrightled.com
forthrightled
17
https:// www. forthrightled.com
com
forthrightled.com
472
fashiongemini.com
fashiongemini.com
fashiongemini
17
https:// www. fashiongemini.com
com
fashiongemini.com
473
flashconway.com
flashconway.com
flashconway
15
https:// www. flashconway.com
com
flashconway.com
474
fallinloveia.com
fallinloveia.com
fallinloveia
16
https:// www. fallinloveia.com
com
fallinloveia.com
475
fuwuqijg.com
fuwuqijg.com
fuwuqijg
12
https:// www. fuwuqijg.com
com
fuwuqijg.com
476
forthebrotherscoffee.com
forthebrotherscoffee.com
forthebrotherscoffee
24
https:// www. forthebrotherscoffee.com
com
forthebrotherscoffee.com
477
forensicunderwriting.com
forensicunderwriting.com
forensicunderwriting
24
https:// www. forensicunderwriting.com
com
forensicunderwriting.com
478
finishinglinesfaux.com
finishinglinesfaux.com
finishinglinesfaux
22
https:// www. finishinglinesfaux.com
com
finishinglinesfaux.com
479
familytherapistpedia.com
familytherapistpedia.com
familytherapistpedia
24
https:// www. familytherapistpedia.com
com
familytherapistpedia.com
480
fmm77.com
fmm77.com
fmm77
9
https:// www. fmm77.com
com
fmm77.com
481
fintechdive.com
fintechdive.com
fintechdive
15
https:// www. fintechdive.com
com
fintechdive.com
482
fakeideurope.com
fakeideurope.com
fakeideurope
16
https:// www. fakeideurope.com
com
fakeideurope.com
483
feedimaster.com
feedimaster.com
feedimaster
15
https:// www. feedimaster.com
com
feedimaster.com
484
faiue.com
faiue.com
faiue
9
https:// www. faiue.com
com
faiue.com
485
faresamer.com
faresamer.com
faresamer
13
https:// www. faresamer.com
com
faresamer.com
486
foamweasel.com
foamweasel.com
foamweasel
14
https:// www. foamweasel.com
com
foamweasel.com
487
fenixventuresllc.com
fenixventuresllc.com
fenixventuresllc
20
https:// www. fenixventuresllc.com
com
fenixventuresllc.com
488
forkids24.com
forkids24.com
forkids24
13
https:// www. forkids24.com
com
forkids24.com
489
fannynails.com
fannynails.com
fannynails
14
https:// www. fannynails.com
com
fannynails.com
490
freeholdsoccerleague.com
freeholdsoccerleague.com
freeholdsoccerleague
24
https:// www. freeholdsoccerleague.com
com
freeholdsoccerleague.com
491
fanfraphs.com
fanfraphs.com
fanfraphs
13
https:// www. fanfraphs.com
com
fanfraphs.com
492
fuglyscrub.com
fuglyscrub.com
fuglyscrub
14
https:// www. fuglyscrub.com
com
fuglyscrub.com
493
financialadvisorfortcollins.com
financialadvisorfortcollins.com
financialadvisorfortcollins
31
https:// www. financialadvisorfortcollins.com
com
financialadvisorfortcollins.com
494
flight-hospitality.com
flight-hospitality.com
flight-hospitality
22
https:// www. flight-hospitality.com
com
flight-hospitality.com
495
fancameo.com
fancameo.com
fancameo
12
https:// www. fancameo.com
com
fancameo.com
496
faxsails.com
faxsails.com
faxsails
12
https:// www. faxsails.com
com
faxsails.com
497
fuwfashion.com
fuwfashion.com
fuwfashion
14
https:// www. fuwfashion.com
com
fuwfashion.com
498
fivestartswimschool.com
fivestartswimschool.com
fivestartswimschool
23
https:// www. fivestartswimschool.com
com
fivestartswimschool.com
499
flowasyouwish.com
flowasyouwish.com
flowasyouwish
17
https:// www. flowasyouwish.com
com
flowasyouwish.com
500
flowine.com
flowine.com
flowine
11
https:// www. flowine.com
com
flowine.com

Current page (1) | Next page (2) | All Pages

Last 100 days domain names registered

  1. Mon, 20 May, 2019
  2. Sun, 19 May, 2019
  3. Sat, 18 May, 2019
  4. Fri, 17 May, 2019
  5. Thu, 16 May, 2019
  6. Wed, 15 May, 2019
  7. Tue, 14 May, 2019
  8. Mon, 13 May, 2019
  9. Sun, 12 May, 2019
  10. Sat, 11 May, 2019
  11. Fri, 10 May, 2019
  12. Thu, 9 May, 2019
  13. Wed, 8 May, 2019
  14. Tue, 7 May, 2019
  15. Mon, 6 May, 2019
  16. Sun, 5 May, 2019
  17. Sat, 4 May, 2019
  18. Fri, 3 May, 2019
  19. Thu, 2 May, 2019
  20. Wed, 1 May, 2019
  21. Tue, 30 Apr, 2019
  22. Mon, 29 Apr, 2019
  23. Sun, 28 Apr, 2019
  24. Sat, 27 Apr, 2019
  25. Fri, 26 Apr, 2019
  26. Thu, 25 Apr, 2019
  27. Wed, 24 Apr, 2019
  28. Tue, 23 Apr, 2019
  29. Mon, 22 Apr, 2019
  30. Sun, 21 Apr, 2019
  31. Sat, 20 Apr, 2019
  32. Fri, 19 Apr, 2019
  33. Thu, 18 Apr, 2019
  34. Wed, 17 Apr, 2019
  35. Tue, 16 Apr, 2019
  36. Mon, 15 Apr, 2019
  37. Sun, 14 Apr, 2019
  38. Sat, 13 Apr, 2019
  39. Fri, 12 Apr, 2019
  40. Thu, 11 Apr, 2019
  41. Wed, 10 Apr, 2019
  42. Tue, 9 Apr, 2019
  43. Mon, 8 Apr, 2019
  44. Sun, 7 Apr, 2019
  45. Sat, 6 Apr, 2019
  46. Fri, 5 Apr, 2019
  47. Thu, 4 Apr, 2019
  48. Wed, 3 Apr, 2019
  49. Tue, 2 Apr, 2019
  50. Mon, 1 Apr, 2019
  51. Sun, 31 Mar, 2019
  52. Sat, 30 Mar, 2019
  53. Fri, 29 Mar, 2019
  54. Thu, 28 Mar, 2019
  55. Wed, 27 Mar, 2019
  56. Tue, 26 Mar, 2019
  57. Mon, 25 Mar, 2019
  58. Sun, 24 Mar, 2019
  59. Sat, 23 Mar, 2019
  60. Fri, 22 Mar, 2019
  61. Thu, 21 Mar, 2019
  62. Wed, 20 Mar, 2019
  63. Tue, 19 Mar, 2019
  64. Mon, 18 Mar, 2019
  65. Sun, 17 Mar, 2019
  66. Sat, 16 Mar, 2019
  67. Fri, 15 Mar, 2019
  68. Thu, 14 Mar, 2019
  69. Wed, 13 Mar, 2019
  70. Tue, 12 Mar, 2019
  71. Mon, 11 Mar, 2019
  72. Sun, 10 Mar, 2019
  73. Sat, 9 Mar, 2019
  74. Fri, 8 Mar, 2019
  75. Thu, 7 Mar, 2019
  76. Wed, 6 Mar, 2019
  77. Tue, 5 Mar, 2019
  78. Mon, 4 Mar, 2019
  79. Sun, 3 Mar, 2019
  80. Sat, 2 Mar, 2019
  81. Fri, 1 Mar, 2019
  82. Thu, 28 Feb, 2019
  83. Wed, 27 Feb, 2019
  84. Tue, 26 Feb, 2019
  85. Mon, 25 Feb, 2019
  86. Sun, 24 Feb, 2019
  87. Sat, 23 Feb, 2019
  88. Fri, 22 Feb, 2019
  89. Thu, 21 Feb, 2019
  90. Wed, 20 Feb, 2019
  91. Tue, 19 Feb, 2019
  92. Mon, 18 Feb, 2019
  93. Sun, 17 Feb, 2019
  94. Sat, 16 Feb, 2019
  95. Fri, 15 Feb, 2019
  96. Thu, 14 Feb, 2019
  97. Wed, 13 Feb, 2019
  98. Tue, 12 Feb, 2019
  99. Mon, 11 Feb, 2019
  100. Sun, 10 Feb, 2019

Homepage | Privacy Policy

Our sites: Download Apps | Song Lyrics | Submit Articles

Copyright © 2019 Domain Name Registered . All rights reserved.
Cached: IP: 34.207.82.217, 24 May, 2019 19:08:31 (LONDON - UK).

Domain-Name-Registered.Com

All about Domain Name, Domain Tools and Domain Name Database

Free Whois Tool

Check the domain name owner, when it first registration, expire..

Free Domain Checker

Check domain available or not, then can buy or renew or back order

Webpage Header Checker

Free check Webpage Header return thats hidden from users

Daily Domain Name Registration

Free tool to check domain name first registered by day